KEGG   Burkholderia sp. CCGE1002: BC1002_0631Help
Entry
BC1002_0631       CDS       T01217                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
bge  Burkholderia sp. CCGE1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:700469..701059
Genome map
AA seq 196 aa AA seqDB search
MDLLLIRHGQSHANVAGLLNSTEQDELTEHGLQQAAKLRTLMESYGFVPDRVFSSPWRRA
LQTTEVLFKDRSDWTVDARLGETNAGRFATWKAEDFRLAFPDWGKHLSDRYEGGESHLEL
AARSVNWLEEEVLRHADQPGLIAAVCHAGPISVISQYLLNVPLSRFPNVLVPNASLTLFR
RNVHTGNFYLQIAGLS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggatcttcttctgattcgccacggccagtcgcatgcgaacgtggccggcctgttgaac
tcgaccgaacaggacgagttgaccgagcatggtctgcagcaggccgcgaagctgcgcacg
ctgatggaaagctacggtttcgtgcccgatcgggttttttcgagcccatggcggcgtgcg
ttgcagaccaccgaagtgctgttcaaggacaggagcgactggaccgtcgacgcccgtctc
ggcgaaaccaatgcagggcggttcgcgacctggaaggccgaagattttcgtctggcgttc
cccgactggggcaaacatctgtcggaccgttacgagggtggtgagtcgcatctcgaactg
gccgcgcgttcggtgaactggctcgaggaggaagtgctgcggcacgcggatcagcccggt
ctgatcgccgcggtgtgccacgcgggaccgatctcggtgatctcgcaatacctgctgaat
gtgccgttgtcccgcttccccaacgtgctggtgccgaacgcatcgctgacgctgttccgg
cgcaacgtgcataccggaaacttttatctgcagattgcagggctgtcatga

DBGET integrated database retrieval system