KEGG   Burkholderia sp. CCGE1002: BC1002_0740Help
Entry
BC1002_0740       CDS       T01217                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1002_0740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_0740
   00052 Galactose metabolism
    BC1002_0740
   00500 Starch and sucrose metabolism
    BC1002_0740
   00520 Amino sugar and nucleotide sugar metabolism
    BC1002_0740
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BC1002_0740
   00524 Butirosin and neomycin biosynthesis
    BC1002_0740
Enzymes [BR:bge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BC1002_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(813868..815784)
Genome map
AA seq 638 aa AA seqDB search
MSTGVQTKAVPGAAQHADGPRLLADIGGTNARFALETGPGEIGSVQVYPCAEYPSVADVI
KKYLKDTKIGRVNHAAIAIANPVDGDQVSMTNHDWTFSIEATRRTLGFDTLLVVNDFTAL
AMALPGLTDTQRVQVGGGQRRPNSVIGLLGPGTGMGVSGLIPADDRWIALGSEGGHATFA
PADEREEIVLHYARKKWSHVSFERVAAGPGLEVIYRALAGRDKKRVPASVNPADVVKRAH
EGEPLAAESVDVFCGILGTFAGNIAVTLGALGGIYIGGGVVPRLGELFARSSFRQRFEAK
GRFEAYLQNVPTYVITAEYPAFLGVSAILAEQLSNRAGGSSSAVFERIRQMRDALTPAER
RVADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIP
VSHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVERAIDLLNGARRIEFYGLGNS
NIVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAM
QAGAQVIAITSSNTPLAKRATVALETDHIEIRESQLSMISRILHLVMIDILAVGVAIRRA
VPSDEVAETVEKAREGADDDATAVLDWLSHGAASSARD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgtgcaaactaaagctgtgccgggcgcggcccagcacgccgatggaccg
aggctgctggccgacatcggcggtaccaatgcgcgtttcgcgctcgagacgggccccggc
gaaatcggctcggtgcaggtctatccctgcgccgagtatccgagcgtcgccgacgtcatc
aagaagtacctgaaggacacgaagatcggccgcgtcaatcacgcggcgatcgcgattgcg
aacccggtcgacggcgaccaggtcagcatgaccaatcacgactggaccttttcgatcgaa
gcgacgcgccgcacgctcggcttcgacacgctgctcgtcgtcaacgacttcaccgcgctc
gcgatggcgctgcccggcctcaccgacacgcagcgcgtgcaggtcggcggcggccagcgc
cggccgaacagcgtgatcggcctgctcggccccggcaccggcatgggcgtctcgggcctg
atccccgccgacgaccgctggatcgcgctcggcagcgaaggcggccacgccaccttcgcg
cccgccgacgagcgcgaagagatcgtgctgcactacgcgcgcaagaagtggtcgcacgtt
tcgttcgaacgggtggccgcgggcccgggcctcgaggtgatctatcgcgcgctcgcgggc
cgcgacaagaaacgcgtgccggccagcgtcaacccggccgatgtggtcaagcgcgcgcac
gaaggcgagccgctcgcggccgaatcggtcgacgtgttctgcggcattctcggcaccttc
gccggcaacatcgcggtgacgctcggcgcgctcggcggcatctatatcggcggcggtgtc
gtgccgcgtctcggcgagttgttcgcgcgttcgtcgttccgccagcgcttcgaggcgaag
ggccgcttcgaggcgtatctgcagaatgtgccgacctatgtgatcaccgccgaatacccg
gcgttcctcggcgtatcggcgattctcgcggagcagctgtcgaaccgcgcgggcggcagc
tcgtcggcggtgttcgagcggattcgccagatgcgcgacgcgctgacgccggccgagcgc
cgcgtcgccgatctcgcgctgaaccatccgcgttcgatcatcaacgatccgatcgtcgac
atcgcgcgcaaggccgacgtcagtcagccgaccgtgatccgcttctgccgctcgctcggc
tgccaggggttgtcggatttcaagctgaagctcgcgaccggtttgaccggcacgattccg
gtcagccacagccaggtgcatctcggggacaccgcgaccgacttcggcgcgaaggtgctc
gacaacaccgtgtcggcgatcctgcagttgcgcgagcatctgaacttcgagcacgtggaa
cgcgcgatcgacctgctgaacggagcacggcgcatcgagttctacgggctcggcaattcg
aacatcgtcgcgcaggacgcgcactacaagttcttccgtttcggtattccgaccatcgcg
tacggtgacctgtacatgcaggcagcctcggccgcgctgctcggcaagggcgacgtgatc
gtcgcggtgtcgaagtcggggcgcgcgcccgagctgctgcgcgtgctcgacgtcgcgatg
caggccggcgcgcaggtgatcgcgatcacctcgagcaacacgccgctcgcgaagcgcgcg
acggtcgcgctggaaaccgatcacatcgagattcgcgagtcgcagctgtcgatgatctcg
cgcatcctgcacctcgtgatgatcgacattctcgcggtcggtgtggcgattcgtcgcgcg
gtgccgagcgatgaagtggccgagaccgtcgagaaagcgcgcgaaggcgccgacgacgac
gcgactgccgtactcgactggctgagccacggcgcggcttcgtcggcgcgcgactga

DBGET integrated database retrieval system