KEGG   Burkholderia sp. CCGE1002: BC1002_0775Help
Entry
BC1002_0775       CDS       T01217                                 

Definition
hypothetical protein
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bge00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:857033..859024
Genome map
AA seq 663 aa AA seqDB search
MAAGTPEKAGFTVVITRPAGQSSELVERLEAAGLTSLDFPLIDIAPVIDDAPLCAALASL
ERYALVVFVSPNAVDHAFARHHDIWPHALPVGVVGPGSVHALARHGVSAPEHRVISPAAG
ADDESTSFDSEGLFAAIEAQFGAAGLEGKRVLIVRGDGGREWLSERLREAGAEVDTVAAY
RRIVPEPSIGAWARVHELLAGAPHAWLLTSSEGVRNLQELAHEHLTADEIEQLKHAPLVT
PHPRIAQTARALGFDRITVSGAGDERIVRALVAAAAVPSVVQPVSSNPAQPRMTETNAST
NASPQPPASAPLPPNQPFTPYEAQKRRSTSGPLLWFVIVVIACAVGVGGFAMNRKLVRTE
QELAQRQQANDTQTNELRIKIDQALATVHQSDSQVAQLEGKLADAQAAQQALQQQYADLA
RNRDDWTLAEVGQMLSAASQQLQLTGNTQLALFALQSADTRLAASDSPQAVAVRKAIAQD
IDKLKAAPSTDLTGLAIKLDNAIDHVSGLPLSGEEPIPRATPHAATRADTAKVAAATGKP
RWEVWIDEITHGIGEQLSSLVQVRRIDNADAMLVSPDQGYFVRQNLKLRLLSARLALLSR
NQTTLKSDLQAAQSALTRYFDTSSKDTQMVIDLVKQVDAGSAAVELPNLDTSLQAVNQYR
NRG
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggcacgcccgagaaggcggggttcacggtcgtgatcacccggccggccggc
cagtcgagcgagctcgtcgaacggctcgaagcagccggactcacgtcgctcgacttcccg
ctgatcgacatcgcgcccgtcatcgacgacgcgccgttgtgcgccgcgctcgcgtcgctc
gaacgctatgcgctggtcgtgttcgtgtcgccgaacgcggtcgatcacgcgttcgcgcgc
catcacgatatctggccgcacgcgctgccggtcggcgtggtgggcccgggcagcgtgcat
gcgctggcgcgccacggcgtcagcgcgccggagcatcgcgtaatcagccccgcggccggc
gccgacgacgaatcgacgagcttcgactccgagggcctgtttgccgcgatcgaggcgcaa
ttcggcgccgcgggcctcgaaggcaagcgcgtgctgatcgtgcgcggcgacggcggacgc
gagtggctgagcgagcgcctgcgtgaagctggcgcggaagtcgacacggtcgctgcgtac
cggcgcatcgtgccggagccgtcgatcggcgcctgggcgcgcgtgcacgaactgctcgcg
ggcgcgccgcacgcatggcttctgaccagctccgaaggcgtacgcaatctgcaggaactc
gcacacgaacacctgaccgccgacgagatcgagcagctcaaacacgcgccgctcgtcacg
ccgcatccccgcatcgcgcagaccgcgcgggcattgggttttgataggattacggtgtcc
ggcgcgggcgacgaacgcatagtccgagccctcgtggccgcggccgccgtgccttccgtc
gtccaaccggtatcgtccaacccggctcaaccacgcatgactgaaacgaacgcatccacg
aacgcctcacctcagccgccggcaagcgctcccttgccgccgaatcaacccttcacgccg
tacgaagcgcaaaagcgccgcagcacgagcggaccgctgctgtggtttgtcatcgtggtc
atcgcgtgcgcggtgggcgtgggcggcttcgcgatgaaccgcaagctggtgcgcaccgag
caggagctcgcgcagcgtcagcaggccaacgacacgcagaccaacgagctgcgcatcaag
atcgaccaggccctcgccaccgtgcatcaatcggattcgcaggttgcgcagctcgaaggc
aagctcgccgatgcgcaggccgcgcagcaggcgctgcaacagcaatacgcggatctcgcg
cgcaatcgcgacgactggacgctcgccgaagtcgggcagatgctgtcggcggcgagccag
cagttgcagctgaccggcaatacgcagctcgcgctgttcgcgttgcaaagcgccgatacg
cgcctcgcggcatccgacagtccgcaagcggtcgcggtgcgcaaggccatcgcgcaagat
atcgacaaactgaaggcggcaccgtccaccgatctgactggcctggccatcaaactcgac
aacgcgatcgatcacgtgagcggcctgccgctgtcgggtgaagagccgattccgcgtgcc
acgccgcacgcggccacgcgggccgacaccgcgaaggtcgcagcggccaccggcaagccg
cgctgggaagtgtggatcgacgagatcacgcacggcatcggcgaacagctgtcgagcctc
gtgcaggtgcgccgtatcgataacgccgatgcgatgctggtctcgccggaccaaggctac
ttcgtgcgccagaacctgaagctgcgtctgctgtcggcgcgtctcgcgctgctgtcgcgc
aaccagaccacgctgaagtccgacctgcaggcggcgcagtccgcgttgacgcgctacttc
gacacgtcgtcgaaagacacgcagatggtcatcgatctggtcaagcaggtggacgccggt
tcggccgcggtcgagctgccgaacctcgatacgagcctgcaggccgtcaatcaataccgg
aaccggggttaa

DBGET integrated database retrieval system