KEGG   Burkholderia sp. CCGE1002: BC1002_0954Help
Entry
BC1002_0954       CDS       T01217                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1002_0954
   01230 Biosynthesis of amino acids
    BC1002_0954
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_0954
   00051 Fructose and mannose metabolism
    BC1002_0954
   00562 Inositol phosphate metabolism
    BC1002_0954
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1002_0954
Enzymes [BR:bge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BC1002_0954
Exosome [BR:bge04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BC1002_0954
  Exosomal proteins of bladder cancer cells
   BC1002_0954
  Exosomal proteins of melanoma cells
   BC1002_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1057320..1058096
Genome map
AA seq 258 aa AA seqDB search
MSNQQRAKLVVGNWKMHGRLAANAALLQAVVQGANELPADVRVGVCVPSLYLAQTQSLLE
GTSVVWGVQDVSAFTHGAYTGEVAAPMVTDFGATFAIVGHSERRAYHRESAELVAVKAQR
VLDAGLTPIVCVGETLEEREAGSTEQVVGGQLDEVLAKLSAQEAARLVVAYEPVWAIGTG
KSASAAQAQAVHAFLRARLAAKGAADVPLLYGGSVKPDNAEELFRQNDIDGGLIGGASLK
DQDFLAICKAAAATTVAD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcaacaacgagccaaactggtagtcggtaactggaagatgcatgggcggctc
gccgcgaacgccgcgttgttgcaggcagtggtgcagggcgccaatgaattgccggcggat
gtgcgcgttggtgtctgcgtgccgagcctctatctcgcgcaaacgcagtcgctgctcgaa
ggcacctcggtcgtgtggggcgtgcaggacgtgtccgcgttcacgcatggcgcctatacc
ggcgaagtggctgcgccgatggtgacggacttcggtgccacgtttgcgatcgtcgggcac
tcggagcgccgcgcgtatcaccgcgaaagcgccgagctggttgcggtgaaagcgcagcgt
gtgctcgatgcgggtttgacgccgatcgtgtgcgtcggcgaaacgctcgaagaacgcgaa
gctggttcgaccgagcaggtcgtcggcggtcagctcgacgaagtactcgcgaagctgtcg
gctcaggaagcggctcgcctcgtcgtcgcgtatgagccggtatgggcaattggtaccggc
aagagcgcatcggcggcgcaagcgcaggccgtgcatgcgtttctacgcgcacgtctcgcg
gcgaagggtgcggcggacgtgccgttgctgtacggcggcagcgtgaagccggacaacgcg
gaagagctattccgtcagaacgatatcgatggcggcctgatcggtggcgcgtcgttgaaa
gatcaggatttcctggcgatttgcaaggcggccgctgcgaccactgtggcggattaa

DBGET integrated database retrieval system