KEGG   Burkholderia sp. CCGE1002: BC1002_1033Help
Entry
BC1002_1033       CDS       T01217                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1002_1033
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_1033
   00620 Pyruvate metabolism
    BC1002_1033
   00640 Propanoate metabolism
    BC1002_1033
  Energy metabolism
   00680 Methane metabolism
    BC1002_1033
Enzymes [BR:bge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BC1002_1033
Lipid biosynthesis proteins [BR:bge01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BC1002_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1138006..1139988
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLQERRVFPPSADTAKGATISGMDAYRALAAEAERDYEGFWGRLAKETLSWHKP
FTKVLDESKAPFYTWFEDGQLNASYNSIDRHVEAGNGGRVAIVFEADDGTVTNVTYQDLL
QRVSRFANALKKRGVKKGDPVVIYMPMSIEAIVAMQACARIGATHSVVFGGFSSKSLNER
LVDVGAVALITSDEQMRGGKALPLKNIADEALALGGCEKVKSVIVYQRTGGKVAWDAARD
LWMHELTQGESDQCAPEWVDAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTLKWTFD
WRPSDVFWCTADIGWITGHSYITYGPLTLGGTQVVFEGVPTYPDAGRFWQMIAKHKVTLF
YTAPTAIRSLIKASEADAKVHPKSYDLSTLRIIGTVGEPINPEAWVWYYENVGGGRCPIV
DTWWQTETGGHMIAPMPGATPLVPGSCTLPVPGIMAAVVDETGQDVPNGQGGILVVKRPW
PAMLRNVWGDPDRYKKSYFPEELGGKLYLAGDGAVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVANPLVAEAAVVGRPDATTGEAVCAFVVLKRARPQGEEAVKLANELRNWVG
KEIGPIAKPKDIRFGENLPKTRSGKIMRRLLRSLAKGEEITQDVSTLENPAILDQLGESI
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttcttcaggaacgccgcgtttttccgccctccgctgacacg
gcgaagggtgccactatctccggcatggacgcgtaccgggcgctcgccgccgaagcggag
cgcgactacgaaggcttttgggggcgtcttgcgaaggagacgctaagttggcacaagcca
ttcacgaaggtgctcgacgagtcgaaggcgccgttctacacgtggttcgaagacggccag
ctgaacgcgtcgtataacagcatcgaccgtcacgtcgaggccggcaacggcgggcgcgtc
gcgatcgtgttcgaagccgacgacggcaccgtcaccaacgtcacctatcaggatctgctg
caacgtgtatcgcgcttcgcgaatgcgctgaaaaagcgcggcgtgaagaagggcgacccg
gtcgtcatctatatgccgatgtcgatcgaggccatcgtcgcgatgcaggcgtgcgcgcgc
atcggcgcgacgcactcggtcgtgttcggcggcttctcgtcgaagtcgctcaacgagcgg
ctcgtcgacgtcggcgcggtcgcgctgatcacgtccgacgagcagatgcgcggcggcaag
gccttgccgctgaagaacatcgccgacgaagcgctcgcgctcggcggctgcgaaaaggtc
aagagcgtgatcgtgtaccagcgcaccggcggcaaggtcgcgtgggacgcggcgcgcgac
ctgtggatgcacgaactcacgcagggcgagtcggaccagtgcgcgcccgaatgggtcgac
gccgagcatccgctcttcatcctttatacgtcgggctcgaccggcaagccgaagggcgtg
cagcacagcaccggcggctatctgctgtgggccgcgcaaacgctgaagtggaccttcgac
tggcgcccgtccgacgtgttctggtgtaccgccgacatcggctggatcaccggccatagc
tacatcacgtacggaccgctgacgctcggcggcacccaggtcgtgttcgaaggcgtaccg
acctatccggacgccgggcgcttctggcagatgatcgcgaagcacaaggtcacgttgttc
tatacggcaccgactgcgatccgctcgctgatcaaggcctccgaggccgacgcgaaagtg
catccgaagagctacgacctgtcgacgctgcgcatcatcggcacggtcggcgaaccgatc
aatccggaagcgtgggtgtggtactacgagaacgtcggcggcggccgttgtccgatcgtc
gatacatggtggcagaccgagaccggcggccacatgattgcgccgatgccgggcgcgacg
ccgctcgtgccgggttcttgcacgctgcctgtgccgggcatcatggccgcggtcgtcgac
gaaacgggccaggacgtgccgaacgggcagggcggcattctggtggtcaagcgtccgtgg
ccggcgatgctgcgcaacgtgtggggcgatccggaccgctacaagaagagctacttcccc
gaggagctcggcggcaagctttatctcgccggcgacggcgcggtgcgagataaggaaacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtgtcgggccatcgactc
ggcacgatggagatcgagtcggcgctggtcgccaatccgctcgtcgcggaagctgccgtg
gtgggccgccccgatgcgacgaccggcgaggcggtatgcgcgttcgtcgtgctcaagcgt
gcgcgtccgcaaggcgaagaggccgtcaagctcgcgaacgaactgcgcaactgggtcggc
aaggagatcggtcctatcgcgaaaccgaaggacatccgcttcggcgagaacctgccgaag
acgcgttcgggcaagatcatgcgtcgtctgttgcgctcgctcgcgaagggagaggagatc
acgcaggacgtgtcgacgctggagaacccggcgattctcgaccagctcggcgagtcgatt
taa

DBGET integrated database retrieval system