KEGG   Burkholderia sp. CCGE1002: BC1002_1057Help
Entry
BC1002_1057       CDS       T01217                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00521  Streptomycin biosynthesis
bge00523  Polyketide sugar unit biosynthesis
bge01130  Biosynthesis of antibiotics
Module
bge_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BC1002_1057
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BC1002_1057
Enzymes [BR:bge01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BC1002_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADG15146
JGI: BC1002_1057
UniProt: D5W675
Position
1:1172454..1173005
Genome map
AA seq 183 aa AA seqDB search
MGNRVMATALPEVKLIEPEVFIDEYGFCFESFSADEFSDDVAQGFNFVQDRHLRAVHGVL
RGLHYQVQRPQGRLLRVVRGEIFDVAVDVRLNSPNFGKWSGEYLNEENQRQIWVPPGFAH
GFVVLSEVAECVWKTTEYWFPELERCLLWSDPDIGIDWPIDFQPILGSKDAAGRRLYEAE
NIS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacagggtcatggcgacggcattgccggaggtgaaactcatcgagccggaagtg
ttcatcgacgagtacggcttctgcttcgagagtttcagcgcggacgaattttcggacgac
gtcgcgcaaggtttcaacttcgtgcaagaccgccatctgcgcgccgtgcatggcgtgctg
cgcggcttgcactaccaggtgcagcgtccgcagggacggctgctgcgcgtcgtgcgcggc
gagatcttcgacgtcgcagtcgacgtgcgcctgaactccccgaacttcggcaaatggagc
ggcgagtatctgaacgaggagaaccagcggcagatctgggtgccgcccggtttcgcgcac
ggcttcgtcgtgctgtccgaggtcgccgaatgcgtgtggaagaccaccgagtattggttt
cccgagctcgaacgctgcctgctgtggtccgatcccgacatcggcatcgactggccgatc
gactttcaaccgattctcggcagcaaggatgcggcgggtcgccgtctgtacgaagccgaa
aacatctcgtga

DBGET integrated database retrieval system