KEGG   Burkholderia sp. CCGE1002: BC1002_1062Help
Entry
BC1002_1062       CDS       T01217                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1002_1062
Enzymes [BR:bge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BC1002_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1177606..1178901
Genome map
AA seq 431 aa AA seqDB search
MSQSKGRALWRAVRDRVGVESGAGLRARFARRLVRTTAGVPATVLATMLTLASSHNAFAT
QAPQPGRADLTACAAAPWPRWQQFKRDFLSADGRVIDVGSSDERTVSEGQSYALFFALVA
NDRAAFDTILRWTEQHLSQGDLTARLPAWLWGRSSDGNWAVLDANASSDADLWIAYALLE
AGDAWRERSYTARGAVLARRVLDEETANAPGLGLTLLPGPAGFHPEADVWRVNPSYMPPQ
VLRGLATRLPDDPRWPRLLASTSRILIDTAPQGFSPDWALYRANRGFAPDAETHAESAYN
AIRVYLWAGMLDRRDPLAPALLARFAPFANFIAAHGAPPETVDATNGRAGINMGNAGFSA
AAVPFLDARGQPALADAQIARAAALDRETAAGYYTSVLSLFALGWREGRYRFAADGTLDP
HWSTSCRAAPQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtcgaagggcagagcgctgtggcgggcagtgcgcgatcgggtgggcgttgaa
agtggcgcgggcctgcgcgcgaggttcgcgcgcagactcgtgcgaacaacggcgggcgtt
ccggcaacggtgctggccacgatgctgacgctcgcgagcagccacaacgcgtttgccacg
caagcgccgcagccgggccgcgccgacctcaccgcttgcgccgccgcgccctggccgcgc
tggcagcaattcaagcgcgatttcctgtccgccgatggccgcgtgatcgacgttggttcg
tccgacgagcgcacggtgtcggaggggcaatcgtacgcactgtttttcgcgctggtcgcg
aacgaccgcgcggccttcgacacgatcctgcgctggaccgagcagcatctttcccaaggc
gacctgaccgcgcgtctgccggcgtggctgtggggccgctcgtccgacggcaactgggcc
gtgctcgacgcgaatgcatcgtcggatgccgacttgtggatcgcctatgcgctgctcgaa
gcgggcgacgcgtggcgcgagcgcagctacacggcgcgcggcgcggtgctcgcccgccgc
gtgctcgacgaggaaacggccaacgcgccggggctcggcttgaccttgctgccggggccg
gccggctttcatccggaggccgacgtgtggcgggtcaatccgagctacatgccgccgcag
gtgctgcgcggcctagctacgcggctgcccgacgatccgcgctggccgcgtttgctcgcg
agcacgagccgcatcctgatcgataccgcgccgcagggcttctcgccggattgggcgttg
tatcgcgcgaaccgcggcttcgcacccgacgccgagacccacgccgagagcgcgtacaac
gcgattcgcgtgtacctgtgggccggcatgctcgaccggcgcgatccgctcgcgccggcg
ctgctcgcgcgcttcgcgccgttcgcgaacttcatcgccgcgcacggcgcgccgcccgag
acagtcgacgcgaccaacggccgtgccggcatcaacatgggcaacgccggtttttcggcg
gcggccgtgccgtttctcgatgcgcgcggccagcccgcgctcgccgatgcgcagatcgca
cgcgccgccgcgctcgatcgcgagacggccgccggctattacacgagcgtgctgagcctg
ttcgcgctcggctggcgcgaaggccgctatcgtttcgccgccgacggcaccctcgatccg
cactggagcacgtcgtgccgcgccgcgccgcagtaa

DBGET integrated database retrieval system