KEGG   Burkholderia sp. CCGE1002: BC1002_1171Help
Entry
BC1002_1171       CDS       T01217                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BC1002_1171
Enzymes [BR:bge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BC1002_1171
DNA repair and recombination proteins [BR:bge03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BC1002_1171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD UvrD-helicase DUF2075 PhoH UvrD_C AAA_22 MukB T2SSE CbiA AAA_29 Flavi_DEAD
Motif
Other DBs
NCBI-ProteinID: ADG15256
JGI: BC1002_1171
UniProt: D5W6W1
Position
1:1309594..1311684
Genome map
AA seq 696 aa AA seqDB search
MSTPGTLDERAATPLGLEDIGVNLPAPADFSIALAEGFARRIGMLARRGGASTEVVKWAA
RGAFAASRATAEGHVCVPLAALARRFDASSAEVRAALLASGMASDGAADTAGAAALRPLV
IDAQGRLYLARYYDYERRLAHALVAQATADGSTANVDADTAPAALRERLLRYFGPPRDDE
VDWQRVAAVMALSGRLTIVSGGPGTGKTTTVVGVLACLLDARADLRIALAAPTGKAAQRM
QEALLARAGELPAELAERLPQTSYTLHRLLGSGPGGRFRHHRDNPLPYDVVVIDEASMID
VAMATHLLDAIGAQTRLVMLGDKDQLAAVEAGAVFAELSARPALSASGLRRVAQALDINE
ARLARALPRASRQGDEAPSDDFFVPPEALQTFEADASGDLFAGVATAAGDEQPDRDARSA
NEHNPLADCVVWLERNYRFGLESPIGRLSVAIRNGSPSAALDVLRTDPTEVCAAALHEDA
HTTLTERTMTRLAAGFAPYADALAATLASDTPDPLPLFDALNRFRILCATRLGPRGVDQV
NAAIAAQVRRAAGVTLAVGAQWFAGRPVMVTRNDYALGLFNGDIGIALPGAGGALRVYFR
TGDGGVRAVSPAALPPHDTAFALTVHKSQGSEFEHAVLVLPSAFSRVLSRELVYTAITRA
RERVEVIGARAVLAQAIATPTQRDSGLAARIAEASR
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgccgggcacgcttgacgagcgcgcggccacgccgctcggactcgaagacatc
ggcgtcaacctgcccgcgccggccgatttcagcatcgcgctggccgaagggttcgcgcgt
cggatcggcatgctggcgcggcgcggtggcgcatcgaccgaggtggtgaagtgggccgcg
cgcggcgcgttcgcggcgagccgcgcgaccgccgaagggcatgtgtgcgtgccgctcgcg
gcgctcgcgcgccgcttcgacgcatcgagcgccgaagtgcgcgcggcgctgctcgcgagc
ggtatggcaagcgatggcgccgcggacacagcgggcgcggcggcgttgcggccgctcgtg
atcgacgcgcaggggcgtctttatctcgcgcgctactacgactacgaacggcgcctggcc
cacgctctggtcgcacaggcgacggccgacgggagcaccgcgaatgtcgacgccgacacc
gcccccgccgctttgcgcgaacgcctgctgcgctacttcggtccgccgagagacgacgaa
gtcgactggcaacgcgtcgcggccgtgatggcgctgtcggggcggctgacgatcgtcagc
ggcggtccgggcaccggcaagaccacgaccgtggtcggcgtgctcgcgtgtctgctcgat
gcgcgcgccgatctgcgcatcgcgctcgcggcgccgaccggcaaggcggcgcaacggatg
caggaagcgttgctcgcgcgcgcgggcgagctgccggcagaactcgccgagcgtttgccg
cagacgtcttacacgctgcatcgtttgctgggctcggggccgggcggacgtttccggcat
catcgcgataatccgttgccgtatgacgtggtcgtgatcgacgaggcgtcgatgatcgac
gtcgcgatggccacacatctgctcgacgcgatcggagcgcaaacgcggctcgtgatgctc
ggtgacaaggaccagctcgccgcggtcgaagccggcgcggtgttcgccgagctcagcgcg
cgtccggcgctgagcgcgagcggattgcggcgggtcgcgcaggcgctcgatatcaacgag
gcgcggctcgcgcgggctttgccgcgcgcgtcgcgtcagggcgatgaagcgccgtcggat
gatttttttgtgccgcccgaggcgctgcaaacgttcgaggcggacgcatcgggcgatctg
ttcgccggtgtcgcgacagcggcgggtgacgagcagcccgaccgcgatgcgcgatcggcg
aacgaacacaacccgctcgcggactgcgtcgtctggctcgagcgcaactaccggttcggc
ctcgagtcgccgatcggccgtttgtcggttgcgattcgcaacggctcaccgagcgcggcg
ctcgacgtattgcggaccgacccgaccgaggtctgtgccgcggcgctgcacgaggacgcg
cacacgacgctgaccgaacgcaccatgacccgacttgccgccggcttcgcgccttacgcc
gacgcacttgccgcgacgctcgccagcgatacgcccgatcccttgccgctgttcgacgcg
ctcaaccgctttcgcatcctctgtgcgacgcggctcggtcctcgcggcgtcgatcaggtc
aatgcggcgatagcggctcaggtgcgccgcgccgcgggcgtcacgctcgcggtcggcgcg
cagtggtttgccggacggccggtgatggtgacgcgcaacgactacgcgctggggctgttc
aatggcgacatcggcattgcgctgccgggcgcgggcggcgcgctgcgcgtgtatttccgc
accggcgacggcggcgtgcgcgcagtgtcaccggccgcgctgccgccgcacgacaccgcg
ttcgcgctgacggtccacaagtcgcaaggctcggagttcgagcacgcggtgctggtgctg
ccgtcggcgttcagccgggtgttgtcgcgtgagctcgtgtacacggcgattactcgcgcg
cgcgaacgcgtcgaggtgatcggcgcgcgggccgtgctcgcgcaggcgatcgcgacgccg
acgcagcgtgattcggggctggccgcgcggattgcggaggcgtcgcgttga

DBGET integrated database retrieval system