KEGG   Burkholderia sp. CCGE1002: BC1002_1198Help
Entry
BC1002_1198       CDS       T01217                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:bge01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bge00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bge00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1342734..1344002
Genome map
AA seq 422 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPAAGVLAQV
ISNDGDTVTADQVIAKIDTEGTAGAAAVEAEVKPAPVAAAAPAPAAQAATATGSNTAASP
AAGKLMAEKGLAAGDVAGTGRDGRITKGDVLTAGAPAAKAAPAPAAAPKAAKPSLPDVKA
PASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKYKDK
FEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPI
LRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQS
AILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDPARLLL
DL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggttccccagctctccgagtcggtctcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaggctgtcgctcaggacgaaatcctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggctccggcagcaggcgtgctcgcgcaagtc
atctcgaacgacggcgacacggtcacggcggatcaggtgatcgcgaagatcgacaccgaa
ggcaccgcaggcgccgccgctgtcgaagcggaagtgaagccggctccggtcgccgcagcg
gctcccgcgccggcagctcaggctgctaccgcaacgggctcgaacaccgcagcttcgccg
gctgccggcaagctgatggccgagaagggtctggccgctggcgacgtcgctggcacgggc
cgcgacggccgcatcaccaagggcgacgtgctcaccgctggcgcaccggctgccaaggct
gcaccggctccggctgccgcaccgaaggctgcgaagccgtcgctgccggacgtcaaggct
ccggcatcggccgaccagtggctgaaggaccgtccggaacagcgcgtgccgatgtcgcgt
ctgcgtgcgcgtatcgccgagcgtctgctcgagtcccagcaaaccaacgccatcctcacg
acgttcaacgaagtgaacatggcgccggtcatggagctgcgcaacaagtacaaggacaag
ttcgagaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcggctgtt
catgcgctgaagaagttcccgctcgtgaacgcatcgatcgacggtaacgacatcgtctat
cacggctacttcgacatcggtatcgcggtcggttcgccgcgcggtctggtggtgccgatc
ctgcgcaatgcagaccagctgagcctcgccgacatcgagaagaagatcgccgaattcggc
cagaaggcgaaggacggcaagctgtcgatcgaagaaatgaccggcggtacgttctcgatc
tcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccgccgcagtcc
gcgattctcggcgtgcacgccacgaaggaacgcgctgtcgtcgaaaacggccagatcgtg
atccgcccgatgaactacctcgcgctgtcgtacgaccatcgtatcatcgacggccgcgaa
gccgtgctgtcgctggtcgccatgaaggacgcgctggaagatccggcacgtctgctgctt
gacctgtaa

DBGET integrated database retrieval system