KEGG   Burkholderia sp. CCGE1002: BC1002_1379Help
Entry
BC1002_1379       CDS       T01217                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BC1002_1379
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1002_1379
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BC1002_1379
Enzymes [BR:bge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BC1002_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1532810..1534261
Genome map
AA seq 483 aa AA seqDB search
MNYLSTRGAGAGERHTFSDILLGGLAKDGGLYLPAEYPRVTADELTRWRTLPYADLAYEI
LSKFCDDIPADDLRALTRKTYTAATYCNVRDDESAAQITPLKTLGVEDGAPLSLLELSNG
PTLAFKDMAMQLIGNLFEYALAKHGETLNILGATSGDTGSAAEYAMRGKKGIRVFMLSPH
KKMSAFQTAQMYSLQDPNIFNLAVEGVFDDAQDIVKAVSNDHAFKAKYKIGTVNSINWAR
VVAQVVYYFKGYFAATKSNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGIYRVRKAAETYHTSSPSMDISKASNFERFVYDLLGRDPARVLQLFRDVEEKG
GFDLAASGDFARVNEFGFVSGSSSHDTRVETIRDVFQRYDTMIDTHTADGVKVAREHLQP
GVPMIVLETAQPIKFGETIREALLREPERPAAFSGLESLPQRFEVVPADAQRVKDFIVAN
TGE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctctccacgcgcggcgccggagccggcgagcgccataccttctccgacatc
ctgctcggcggtctcgcgaaagacggcggcctctatctgccggccgaatatccccgcgtc
accgcggacgaactcacgcgctggcgcacgctgccgtacgcggatctcgcgtacgagatc
ctgtcgaagttctgcgacgacatccccgccgacgatctgcgcgcgctgacgcgcaagacc
tacacggccgcgacctactgcaacgtgcgcgacgacgaaagcgccgcgcaaatcacgccg
ctgaagacgctcggcgtcgaagacggcgcgccgctgtcgctgctcgaactgtcgaacggt
ccgacgctcgcgttcaaggacatggcgatgcagctgatcggcaacctgttcgagtacgcg
ctcgcgaagcacggcgaaacgctgaacattctcggcgcgacctcgggcgacaccggtagc
gccgccgaatacgcgatgcgcggcaagaagggcatccgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagactgcgcagatgtacagcctgcaagacccgaacatcttc
aacctcgcggtggaaggcgtgttcgacgacgcgcaggacatcgtgaaggcggtgtcgaac
gatcacgctttcaaggcgaagtacaagatcggtacggttaattcgatcaactgggcgcgg
gtcgtcgcgcaggtcgtctactacttcaagggctattttgccgcgacgaagtcgaacgac
gagcgcgtgtcgttcacggtgccgtcgggcaacttcggcaacgtgtgcgcgggtcatatc
gcgcgcatgatgggtctgccgattgagaagctcgtcgtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcatctaccgcgtgcgcaaggcagccgagacgtatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgtacgac
ctgctcggccgtgatccggcgcgagtgctgcaactgttccgcgacgtcgaggagaagggc
ggtttcgacctcgctgcaagcggcgacttcgcgcgcgtgaatgagttcggtttcgtgtcc
ggcagcagcagccacgacacccgcgtcgagacgatccgcgacgtattccagcgctacgac
acgatgatcgacacgcacacggccgacggcgtgaaggtcgcgcgagagcacctgcagccg
ggcgttccgatgatcgtgctcgagaccgcgcagccgatcaagttcggcgagacgatccgc
gaagcgctgctgcgcgaaccggagcggccggcggcattctcggggctcgaatcgctgccg
cagcgcttcgaggttgtccccgcggatgcgcagcgggttaaggacttcatcgtcgcgaac
accggcgagtaa

DBGET integrated database retrieval system