KEGG   Burkholderia sp. CCGE1002: BC1002_1397Help
Entry
BC1002_1397       CDS       T01217                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BC1002_1397
DNA repair and recombination proteins [BR:bge03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BC1002_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1553540..1554136
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAYHLMQHDREGAEKLGRSLLFATEHLRHCEKC
NTFTEAQICEVCLDEERDPSLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVKRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRSM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccttccgccctgtcggcgctcgtcgaagcgctgcgcgtgctgcccggtgtc
gggccgaagtccgcgcagcgcatggcgtatcacttgatgcagcacgatcgcgaaggcgcc
gaaaagctcggccgctcgctgttgttcgcgaccgagcacctgcgtcactgcgaaaagtgc
aacacgtttaccgaagcgcagatctgcgaggtctgcctcgatgaggagcgcgatccgtcg
ctgctgtgcgtcgtcgagaccccggccgaccagatcatgctcgaacagacgatgacctat
cgcggcctctacttcgtgctgatggggcggttgagtccgctcgacggcatcggcccgaag
gagatccatttcgatcggctcgtgaagcgcgcgtcggatggcgtcgtcaaggaagtcgtg
ctggccaccaatttcaccaacgaaggcgaggccaccgcgcattacctcggacagacgctg
aaggcgcgcggccttgccgtcacgcgtctcgcgcgcggcgtgccggtgggcggcgagctc
gaatatgtcgacgccggtacgatcgcgcgcgcgatgctcgaccgtcgttcgatgtag

DBGET integrated database retrieval system