KEGG   Burkholderia sp. CCGE1002: BC1002_1528Help
Entry
BC1002_1528       CDS       T01217                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00040  Pentose and glucuronate interconversions
bge00052  Galactose metabolism
bge00500  Starch and sucrose metabolism
bge00520  Amino sugar and nucleotide sugar metabolism
bge01100  Metabolic pathways
bge01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BC1002_1528
   00052 Galactose metabolism
    BC1002_1528
   00500 Starch and sucrose metabolism
    BC1002_1528
   00520 Amino sugar and nucleotide sugar metabolism
    BC1002_1528
Enzymes [BR:bge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BC1002_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADG15601
JGI: BC1002_1528
UniProt: D5W856
Position
1:1706955..1707872
Genome map
AA seq 305 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIESELEARNKQKLLDLVRSIKPANVDCFYVRQAEALGLGHAVLCAEK
LVGDSPFAVILADDLLHSTKPVMSQLVDTFNHYHSSVIGVETIAREDSRSYGVVDGREWE
DNVIKLSGIVEKPAPDQAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDAVQSLLT
EEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVKAEFEAYLQAYMQNEAPAGEAGQL
TAEAA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcaccaaagccgtgtttcccgtagcgggcctcgggacacgattcctgccg
gctaccaaagcaagtcctaaggaaatgctgccgatcgtcgacaagccgctgatccagtac
gcggtcgaagaagcgatcgccgccggcatcaccgaaatgatcttcgtgacgggccgcagc
aagcgcgcgatcgaagatcacttcgacaaatcttacgagatcgaatccgaactcgaagcg
cgcaacaagcagaagctgctcgatctggtgcgcagcatcaaaccggccaacgtcgactgc
ttttacgtgcgccaggccgaagcgctcggtctcggccatgcggtgctgtgcgccgaaaaa
ctggtgggcgacagcccgttcgccgtgattctcgccgacgacctgctgcatagcacgaag
cccgtgatgagccagctcgtcgatacgttcaatcactatcacagctcggtgatcggcgtc
gaaacgatcgcacgcgaggacagccgctcatacggcgtcgtcgatggccgcgagtgggaa
gacaatgtgatcaagctgtcgggcatcgtcgagaagccagcgccggatcaggcgccgtcg
aatctcggcgtggtcggacgctacgtgctgatgccgacgatcttcaagcatatccgcgcg
ctgaagccgggcgcgggcggcgagttgcaactgacggacgcggtgcagtcgctgctgacc
gaggagcaggtgctcgcgtatcgctacttcggcacgcgcttcgattgcggcagcaagctc
ggatatctgaaagcgaccgtcgaattcgcgctgcgccacccagaggtgaaggccgaattc
gaggcgtatttgcaggcgtatatgcagaacgaagcgcctgccggcgaggcggggcagttg
acggccgaagccgcgtga

DBGET integrated database retrieval system