KEGG   Burkholderia sp. CCGE1002: BC1002_1529Help
Entry
BC1002_1529       CDS       T01217                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1002_1529
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1002_1529
   00630 Glyoxylate and dicarboxylate metabolism
    BC1002_1529
Enzymes [BR:bge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1002_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1707944..1710118)
Genome map
AA seq 724 aa AA seqDB search
MTQMNPRGGLQVAANLDQFVETEALPGTGIDSAAFWSGFDALVHELAPKNRALLAERDRL
QTELDNWHRTHPGPVRDLRAYRAFLEGIGYIVPVPASVQATTDHVDSEISEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIPEAGGAEKQKGYNPVRGAAVIAYARKFLDQAA
PLANGSHADATRYSVENGQLVVALQSGTAAQKTPTQLVGYQGDASAPSAVLLKHNGLHVE
IQIDADDPVGKTDAAHVKDVVVEAAVTTIIDCEDSVAAVDADDKVQLYRNWLGLMNGDLT
EQVTKNGKTFTRRLNADREYTGADGKSQVKLHGRSLLFIRNVGHLMTNPAVLTRDGHEIP
EGILDAVITTLCALRDRQNKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLKLPRN
TIKMGIMDEERRTSLNLLACIAEASARVAFINTGFLDRTGDEMHSAMEAGPMMRKGDMKS
SKWIASYERSNVLVGLSGGLRGRSQIGKGMWAMPDLMHAMLEQKIGHPKAGANTAWVPSP
TAATLHALHYHQVDVQAVQQELERTDYAKVYDELLDGLLTIPVVEKAQWNDDEIRAEVDN
NTQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLYHGVIKRELVEE
TFKRMAKVVDEQNAGDPLYQPMAPSFDTIAFKAAQALVFEGRQQPSGYTEPLLHKFRLEV
KKQG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactcagatgaacccgcgcggcggactgcaggtcgccgccaacctcgaccagttcgtt
gaaaccgaagccctgcccggcaccgggatcgacagtgccgccttctggtcgggtttcgac
gccctcgtgcacgagctggcgccaaaaaatcgggcgttgctcgccgagcgcgaccgcctg
caaaccgaactggacaactggcatcggacccatcccggcccggtgcgggatctgcgcgcg
tatcgtgcgtttctcgaaggcatcggctacatcgtgcccgtgcccgccagcgtccaggcc
acgaccgaccacgtggacagcgaaatctcggagcaggccggcccgcagctcgtcgtaccg
ctgtcgaaccagcgctacgcgctgaacgccgcgaacgcgcgctggggcagcctgtacgac
gcgctgtacggcacggatgcgattcccgaagcgggtggcgcggaaaagcagaaaggctat
aacccggtgcgcggcgccgcggtgatcgcgtacgcgcgcaagttcctcgatcaggccgcg
ccgctcgcgaacggctcgcatgcggatgcgacgcgctatagcgtcgagaacggccagctg
gtcgtcgcgctgcagagcggcactgccgcgcagaagacacccacgcaactcgtcggctat
cagggcgacgcgagtgcgccgtcggcggtgctgctcaagcacaacggcctgcacgtcgag
atccagatcgatgcggacgatccggtcggcaagaccgatgcggcgcatgtgaaggacgtc
gtcgtcgaagcggcggtcacgacgatcatcgattgcgaagactcggtcgcggccgtcgac
gccgacgacaaggtgcagctctatcgcaactggctcggcctgatgaacggcgacctgacc
gaacaggtcacgaagaacggcaagaccttcacgcgccggctcaacgcggatcgcgagtac
accggcgcggacggcaagtcgcaggtcaagctgcatggccgctcgctgctgttcatccgc
aacgtcggccacctgatgacgaacccggccgtattgacccgcgacggccacgagattccg
gaaggcattctcgacgcggtgatcacgacgctgtgcgcgctgcgcgaccgtcaaaacaag
ctgaactcgcgtaccggctcgatctatatcgtgaagccgaagatgcacggcccggccgaa
gtcgcgttcgcgagcgagctgttcgcgcgcgtcgaagacctgctgaagctgccgcgcaat
acgatcaagatgggcatcatggacgaggagcgccgcaccagcttgaacctgctcgcctgt
atcgccgaagcgtcggcgcgcgtcgcgttcatcaacacgggcttcctcgatcgcaccggc
gacgagatgcactcggcgatggaagcgggcccgatgatgcgcaagggcgacatgaagtcg
agcaagtggatcgcgtcgtacgagcgcagcaacgtgctggtcggtttgagcgggggcctg
cgcggccgctctcagatcggcaaaggcatgtgggcgatgccggacctgatgcacgcgatg
ctcgagcagaagatcggccatccgaaggctggcgcgaatacagcgtgggtgccctcgccg
accgccgcgacgctgcacgcgctgcactatcaccaggtcgacgtacaggcggtccagcag
gaactcgaacgcaccgactacgcgaaggtgtacgacgaactgctcgatggcctgctgacg
attccggtcgtcgaaaaagcgcaatggaacgacgacgaaatccgcgccgaggtcgacaac
aacacgcaaggcattctcggctacgtggtgcgctggatcgaccagggcgtcggctgctcg
aaggtgccggacattcacaacgtcggcctgatggaagaccgcgcgacgctgcgaatttcg
agccagcacatcgccaactggctgtatcacggcgtgatcaaacgcgagctcgtcgaggag
acgttcaagcgcatggccaaggtcgtggacgagcagaacgcgggtgatccgctctaccag
ccgatggcgccgagcttcgacacgattgcgttcaaggccgcgcaggcactcgtattcgag
gggcgccagcagcctagcggttataccgagccgttactgcacaaattccggctcgaggtg
aagaagcagggttga

DBGET integrated database retrieval system