KEGG   Burkholderia sp. CCGE1002: BC1002_1594Help
Entry
BC1002_1594       CDS       T01217                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00010  Glycolysis / Gluconeogenesis
bge00071  Fatty acid degradation
bge00350  Tyrosine metabolism
bge00625  Chloroalkane and chloroalkene degradation
bge00626  Naphthalene degradation
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_1594
  Lipid metabolism
   00071 Fatty acid degradation
    BC1002_1594
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC1002_1594
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1002_1594
   00626 Naphthalene degradation
    BC1002_1594
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC1002_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ADG15664
JGI: BC1002_1594
UniProt: D5W8B9
Position
1:1778066..1779082
Genome map
AA seq 338 aa AA seqDB search
MPTMKAVEVKQAGGPLELVEREVPEAGAGHVRIRIQACGICHSDVMTKDGLWPGLTYPRV
PGHEIAGVIDSVGAGVEGWQAGQRVGVGWHGGHCGKCEHCRQGDFVLCKFALIPGISYDG
GYAEYMVAPVEALARIPDDLSDVDAAPLLCAGITTFNAIRNSGARAGDVVAILGIGGLGH
LGVQFARKMGFRTVAIARGQDKAPLAQQLGAHHYIDSKTENVAEKLQALGGAKLILATVT
SGKAMTATLGGLGLNGKLVMVGVSEEPIEVPIVQFIMGRNSVQGWPSGTSADSQDTLAFS
ALTGVKPMIEEYPLAEAAQAYDRMISGHARFRVVLKMV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgatgaaagcagtcgaagtgaagcaggccggcggcccgctcgaactggtcgaa
cgtgaagtgcccgaggcgggcgccggtcacgtgcggatcaggattcaggcttgcggcatc
tgtcatagcgatgtgatgaccaaggacgggctgtggccgggcctcacctatccgcgcgtg
ccgggtcacgagatcgcaggcgtgatcgattcggtcggtgcgggtgtcgagggctggcag
gccgggcagcgtgtcggggtcggctggcacggcgggcattgcggcaaatgcgaacactgc
cgccagggcgacttcgtgctgtgcaagttcgcgctgatccccggcatcagctacgacggc
ggctacgccgaatacatggtggctccggtcgaagcgctggcgcgcattcccgacgatctg
tccgatgtcgatgccgcgccgctgctgtgcgcgggcatcacgaccttcaacgcgattcgc
aatagcggcgcgcgcgccggtgacgtggtcgcgattctgggcatcggcggcctcgggcat
ctcggcgtgcagttcgcgcgcaagatgggctttcgcacggtggcgatcgcgcgcggtcag
gacaaggcgccgctcgcgcagcagctgggcgcgcatcactacatcgacagcaagacggaa
aacgtcgccgagaagctgcaggcactgggcggcgcgaagctgatacttgccacggtgacg
agcggcaaggcgatgaccgccacgctcggcggtctcggcctgaacggcaagctcgtgatg
gtcggcgtttccgaagagccgatcgaagtgccgatcgtgcagttcatcatgggacgcaac
tcggtgcaaggctggccctccggcacctcggccgattcgcaggacacgctcgcgttcagc
gcgctcaccggcgtcaagccgatgatcgaggagtatccgctcgccgaggcggcgcaggcc
tatgaccggatgatcagcggtcacgcgcgtttcagggtggtattgaagatggtctga

DBGET integrated database retrieval system