KEGG   Burkholderia sp. CCGE1002: BC1002_1788Help
Entry
BC1002_1788       CDS       T01217                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bge00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bge00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1997052..1997531)
Genome map
AA seq 159 aa AA seqDB search
MTSIYSFSARTLGGEEASLAKYQGKVMLIVNTASECGFTPQYAGLQKLYDAYAARGLAVL
GFPCNQFGKQEPGDAAQIGSFCEKNYGVTFPMFDKIDVNGPNAHPLFRYLTIEAPGLLGL
EAIKWNFTKFLIGRDGNVVKRYAPLTKPEAITEDIEALL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgatctattcgttttcggcacgcacgctcggcggcgaggaagcgagtctcgcg
aagtaccaaggcaaggtgatgctgatcgtcaataccgcgagcgaatgcgggttcacgccg
cagtacgcgggcttgcagaagctgtacgatgcgtatgcggcgcgcgggctcgcggtgctg
ggttttccgtgcaaccagttcggcaagcaggagccgggcgacgccgcgcagatcggcagc
ttttgtgagaagaactacggcgtcacgttcccgatgttcgacaagatcgacgtgaacggc
ccgaacgcgcacccgctgttccgctatctgacgatcgaggcgccggggctgctcggtctc
gaagcgatcaagtggaatttcacgaagtttctgatcggccgcgacggcaacgtggtcaag
cgctacgcgccgctgaccaagcccgaggcgatcaccgaggatatcgaagcgctgctgtaa

DBGET integrated database retrieval system