KEGG   Burkholderia sp. CCGE1002: BC1002_1802Help
Entry
BC1002_1802       CDS       T01217                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bge01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bge00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2012434..2013744
Genome map
AA seq 436 aa AA seqDB search
MTMTREQQVQQLKQQWETDPRWKGVKRTYSAEDVVRLRGSVQPEHTLAKRGAEKLWAAVN
SEPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVV
KRINNTLTRADQIQWSEGKNPGDEGYVDYFAPIVADAEAGFGGVLNAFELMKAMIEAGAS
GVHFEDQLASVKKCGHMGGKVLVPTREAVAKLTAARLAADVSGVPTVLLARTDAEAADLV
TSDIDDNDRPFLTGERTVEGFYRTKPGLEQAISRGLAYAPYADMIWCETGKPDLEFAKKF
ADAIHKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHALNYS
MFNLAYGYARNQMTAFVEMQQAEFAAAEKGFTAVKHQREVGTGYFDAVTQTVEREASTTA
LHGSTENEQFFDKKVA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgacccgcgaacagcaagtgcagcaactcaagcagcaatgggaaacggacccg
cgctggaaaggtgtcaagcgcacctactcggccgaagacgtggtacgcctgcgcggctcg
gtgcaacccgagcacacgcttgcgaagcgcggcgccgaaaagctgtgggccgcagtgaac
agcgagccgttcgtcaactcgctcggcgcactgaccggcaaccaggcgatgcagcaagtg
aaggctggtctgaaggcgatctatttgtcgggctggcaggtcgcgggcgatgccaacgtt
gccggtgaaatgtacccggaccaatcgctgtatccggccaactcggtgccgctcgtcgtc
aagcgcatcaacaacacgctgacgcgcgccgaccagatccagtggtcggaaggcaagaac
ccgggcgatgaaggctacgtcgattacttcgcgccgatcgtggccgacgcggaagccggt
ttcggcggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaagcgggcgcgtcg
ggcgtgcacttcgaagaccagctcgcatcggtcaagaagtgcggccacatgggcggcaag
gtgctcgtgccgacccgcgaagccgtcgccaagctgaccgccgcgcgtctggccgccgac
gtgtcgggcgtgccgaccgtgctgctcgcccgcaccgacgcggaagccgccgacctcgtg
acctcggacatcgacgacaacgaccggccgttcctgaccggcgagcgcaccgtcgagggc
ttctatcgtacgaagccgggtctcgagcaggcgatctcgcgcggtctcgcgtacgcgccg
tacgccgacatgatctggtgcgaaaccggcaagccggacctcgagttcgcgaagaaattc
gccgacgcgatccacaaggagtacccggaccagctgctgtcgtacaactgctcgccgtcg
ttcaactggaagaagaacctcgacgacgcgacgatcgcgaagttccagcgcgagctcggt
gcaatgggctacaagttccagttcatcacgctggccggcttccacgcgctgaactactcg
atgttcaacctcgcttacggctatgcgcgcaaccagatgaccgcgttcgtcgagatgcag
caagccgagttcgcggcggccgaaaagggcttcaccgcggtcaagcaccagcgcgaggtc
ggcaccggctacttcgacgcggtcacgcagacggtcgagcgcgaagcatcgacgaccgcg
ctgcacggttcgacggaaaacgaacagttcttcgacaagaaggtcgcctga

DBGET integrated database retrieval system