KEGG   Burkholderia sp. CCGE1002: BC1002_1806Help
Entry
BC1002_1806       CDS       T01217                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1002_1806
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1002_1806
   00630 Glyoxylate and dicarboxylate metabolism
    BC1002_1806
Enzymes [BR:bge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1002_1806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2016508..2018100
Genome map
AA seq 530 aa AA seqDB search
MANPLSLPQGMEITGDIKPGFEAILTREALELVAALHRTFEPRRQQLLQARVERAKRLDA
GERPDFLAATKSVREGDWSIAPLPRDLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWDNQITGHVNLKDAVRRTISLEQNGKSYRLNDKTATLIVRPRGWHLDEKHVKVDG
ERVSGGIFDFVLYMVHNAKELIARGSGPYFYLPKMESHLEARLWNDIFIAAQEAVGVPRG
TIRATVLIETIVAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKSDRDFCLADRSQI
TMTSPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDAAANDKAMAGVRSDKARDAGDG
YDGGWVAHPGLVPVAMEEFVKVLGDRPNQIDKQRIDVLVTATDLLDFRPETPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLDDGRKVTVELV
RELAVQELDKVKQTVGGDTKPYERAAQIFEQMSTAEQFTDFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctgtcgttgccgcaaggcatggaaatcaccggcgacatcaagcccggc
tttgaagcgatcctcacccgcgaagcgctggaactcgtcgcggccttgcatcgtacgttc
gagccgcgccgtcagcagttgctgcaggcgcgcgtcgaacgtgcaaaacggctcgacgcg
ggcgagcggcccgacttcctcgccgccacgaagagcgtgcgcgaaggcgactggagcatc
gcgccgctgccgcgggatctgcagtgccggcgcgtcgagatcaccgggcccgtcgagcgc
aagatgatcatcaacgcgctcaattcgggcgcggactcctacatgaccgacttcgaggat
tcgaatgcgccgagctgggacaaccagatcaccggtcatgtcaatctgaaggacgcggta
cgtcgcacgatctcactcgaacagaacggcaagtcgtaccggctcaacgacaagaccgcg
acgctgatcgtgcgcccgcgcggctggcatctcgacgagaagcacgtgaaggtcgacggc
gagcgcgtgtcgggtggcatcttcgatttcgtgctgtacatggtgcataacgcgaaggaa
ctgatcgcgcgcggctcgggcccgtacttctatctgccgaagatggagagccatctcgag
gcgcgcctgtggaacgacatcttcatcgccgcgcaggaagccgttggcgtgccgcgcggc
acgattcgcgcgacggtgctgatcgagacgatcgtcgccgcattcgaaatggatgaaatc
ctgtacgagctgcgcgagcatagctcgggtttgaacgcgggccgctgggactacatcttc
tccgcgatcaagaagttcaagagcgaccgcgacttctgcctcgccgatcgctcgcagatc
acgatgacctcgccgttcatgcgcgcgtacgcgctgctgttgctgaagacctgccatcgc
cgcaacgcgccggcgatcggcggcatgagcgcgctgattccaatcaagaacgatgcggcc
gcgaacgacaaggcgatggccggcgtgcgctcggacaaggcgcgcgacgcgggcgatggc
tacgacggcggctgggtcgcgcatccgggtctcgtgccggtcgcgatggaagaattcgtc
aaggtgctcggcgaccggccgaatcagatcgacaagcagcgcatcgacgtgctcgtgacc
gcgaccgatctgctcgacttccgcccggaaacgccgatcaccgaagcgggcttgcgcaac
aacatcaacgttggcattcactacctcggttcgtggcttgcgggcaatggctgtgtgccg
attcacaacctgatggaagacgcggccaccgccgagatttcgcgctcgcaggtgtggcag
tggatccgctcgccgaagggcaagctcgacgacggccgcaaggtgacggtcgaactggtg
cgtgagctcgcggtgcaggagctcgacaaggtcaagcaaacggtgggcggagatacgaag
ccatatgaacgcgccgcgcagatcttcgagcagatgtcgaccgcggagcagttcaccgat
tttctgacgctgccgctttacgaagagatttga

DBGET integrated database retrieval system