KEGG   Burkholderia sp. CCGE1002: BC1002_1902Help
Entry
BC1002_1902       CDS       T01217                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1002_1902
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_1902
   00020 Citrate cycle (TCA cycle)
    BC1002_1902
   00620 Pyruvate metabolism
    BC1002_1902
Enzymes [BR:bge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BC1002_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2127311..2128993)
Genome map
AA seq 560 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKAGDTVEKEQSLVTLESDKATMDVPSSADGVVKEV
KVKVGDAVSEGTLIVVLEGANAAAAAPAPAAAPAPAPAPAAAPAAAPAPAPAPAPAPAPA
AAGGGVQEIKVPDIGDYKDVPVIEIAVKVGDRVEKEQSLVTLESDKATMDVPSSAAGVVK
EVKVKVGDNVSEGSVIVVIEAEGGAAAAPAPAPAVKAPTEKPSDAPATPSPAPAAPSALA
QAPLIPAGEGGTRHPSHASPSVRKFARELGVDVSQVKGTGPKGRITQADVTAFVKGVMTG
QRAAPAGAAAPAAGGGELNLLPWPKVDFTKFGPIDPKPLSRIKKISGANLHRNWVMIPHV
TNNDEADITELEALRVKLNKEHEKAGVKFTMLAFVIKACVAALKKFPTFNASLDGDNLVF
KQYYHIGFAADTPNGLVVPVIRDADKKGLVDIAKEMADLSKAAREGKLKPDQMQGGCFSI
SSLGGIGGTHFTPIINAPEVAILGLSRSAMKPVWDGKQFEPRLTMPLSLSYDHRVIDGAE
AARFNAYLGSILADFRRVIL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggacatcggcgattacaaggacgtccctgtg
atcgaggtgctggtaaaggcgggtgacaccgtcgaaaaagagcaatcgctcgttacgctg
gaatccgacaaggcgacgatggacgtgccgagctcggctgacggcgtcgtcaaggaagtg
aaggtcaaggtcggcgatgcggtgtccgaaggcacgctgatcgtcgtgctggaaggcgcc
aacgcggctgccgcggcgcccgcgccggcggcggctccagcgcccgcaccggcaccggcg
gcggctcccgctgcggcacccgcacccgcacccgcacccgcacccgcacccgcacctgcg
gcggcaggcggcggcgtgcaggaaatcaaggtgccggatatcggcgactacaaagacgtt
cccgtgatcgagatcgcggtgaaggtcggcgaccgcgtcgagaaggaacagtcgctcgtc
acgctcgaatccgacaaggcgacgatggacgtgcccagctcggccgccggcgtcgtcaag
gaagtgaaggtcaaggttggcgataacgtgtcggaaggctcggtcatcgtcgtgatcgaa
gcggaaggcggcgctgccgcggcacccgcgccggcaccggccgtgaaggcgccaactgaa
aagccgtccgacgcaccggccacgccgagcccggcaccggccgcgccgtccgcgctcgcg
caggcgccgctgatcccggcgggcgaaggcggcacgcgtcatccgagccacgcttcgccg
tcggtgcgcaagttcgcgcgcgaactcggcgtcgacgtgagccaggtgaagggcacgggt
ccgaagggccgcattacgcaggccgacgtgaccgcgttcgtgaagggcgtgatgaccggc
cagcgcgcggcgccggcaggagccgccgcgccggccgccggcggtggcgaactgaatctg
ctgccgtggccgaaggtcgacttcacgaagttcggtccgatcgatccgaagccgctgtcg
cgcatcaagaagatctcgggcgcgaacctgcatcgcaactgggtcatgatcccgcacgtc
acaaacaacgacgaagcggacatcaccgagctcgaagcgctgcgcgtgaagctgaacaag
gaacacgaaaaggcgggcgtcaagttcacgatgctcgcgttcgtgatcaaggcctgcgtg
gcggccctgaagaaatttccgaccttcaacgcgagcctcgacggcgacaacctggtgttc
aagcagtactaccacatcggttttgccgcggacacgccgaacggcctcgtcgttccggtg
attcgcgacgcggacaagaagggtctcgtcgacatcgcgaaggaaatggccgacctgtcg
aaggccgcgcgcgaaggcaagctgaagccggaccagatgcagggtggctgcttctcgatc
tcgtcgctgggcggtatcggcggcacgcacttcacgccgatcatcaatgcgcctgaagtc
gcgattctcggcctgtcgcgcagcgcgatgaagccggtgtgggacggcaagcagttcgag
ccgcgcctgaccatgccgctgtcgctgtcgtacgaccatcgcgtgatcgacggagcggaa
gccgcgcgcttcaacgcatacctcggttcgattcttgccgatttccggcgtgtgattctt
tga

DBGET integrated database retrieval system