KEGG   Burkholderia sp. CCGE1002: BC1002_2125Help
Entry
BC1002_2125       CDS       T01217                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BC1002_2125
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BC1002_2125
Enzymes [BR:bge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BC1002_2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2387441..2388469)
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGKTLNRDDKRRLAHPMTGGVILFARHYESRAQLVALTDAIRTIRPDL
LIAVDHEGGRVQRFRTDGFTVLPSMGKLGALWDQDVLHATKVTTAVGYILAAELRACGID
MSFTPVLDLDYGHSQVIGDRAFHRDPRVVALLAKSLNHGLALAGMSNCGKHFPGHGFAQA
DSHVAMPVDERPLDEILGNDVAPYDWLGLSLGAVLPAHVVYPAVDAKPAGFSRIWLQDIL
RGKLGFEGAIFSDDLSMEAARQGGTLTEGAQAALEAGCDMVLICNQPDEAEKVLDALRVT
PSKESRRRLKRMRPRGKALTWSKLMAEPRYAEAQRLVRSTFA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccacacccggaccggtgatgctcgacgtggtcggcaaaacgctgaaccgcgat
gacaaaaggcgtctcgcgcacccgatgaccggcggcgtgatcctgttcgcgcgccactac
gagagccgcgcgcaactcgtcgcgctcaccgatgcgatccgtacgattcgcccggatctg
ctgatcgccgtcgatcacgaaggcggccgcgtgcagcgctttcgtaccgacggcttcacg
gtgctgccgtcgatgggcaagctcggcgccctgtgggaccaggacgtgctgcacgcgacg
aaggtgacgaccgcggtcggctacatcctcgccgcggaactgcgcgcgtgcggtatcgac
atgagcttcacgccggtgctcgatctcgactatgggcactcgcaggtgatcggcgatcgc
gcgttccatcgtgacccgcgggtggtcgcgctgctcgcgaagagcctgaaccatggtctg
gcgctagccggcatgagcaactgcggcaagcattttccggggcacggattcgcgcaggcc
gattcgcacgtcgcgatgcccgtcgacgaacgcccgctcgacgagatcctcggcaacgac
gtcgcgccgtacgactggctcggtctgtcgctgggcgcggtgctgcccgcgcacgtggtc
tatccggcggtcgatgcgaaaccggccggcttctcgcgcatctggttgcaggacatcctg
cgcggcaagctgggcttcgaaggggcgatcttcagcgacgacctgtccatggaagccgcg
cgccagggcggcacgctgaccgaaggcgcgcaagccgcgctcgaggccggctgcgacatg
gtgctgatctgcaaccagccggacgaagcggagaaggtgctcgacgcgctgcgcgtgacg
ccgtcgaaggaatcgcggcggcggctgaagcgtatgcggccgcgcggcaaggcgctcacg
tggagcaagctgatggccgagccacggtacgccgaagcgcagaggctggtgcgcagtacg
tttgcataa

DBGET integrated database retrieval system