KEGG   Burkholderia sp. CCGE1002: BC1002_2553Help
Entry
BC1002_2553       CDS       T01217                                 

Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1002_2553
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1002_2553
   00640 Propanoate metabolism
    BC1002_2553
   00660 C5-Branched dibasic acid metabolism
    BC1002_2553
Enzymes [BR:bge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BC1002_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2845015..2846184)
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLEQVREYSNQILGMQLVTHQTGPEGQKVNRLLIEEGADIKKELYVGLVIDRVSQK
IVVMASSEGGMDVEEVAEKTPELIHKVAVDPSTGLKDSEADDLAKKIGVPDASIPQARAI
LQGLYKAFWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKIMLKNPNLTAILVNIFGGIMRCDVIAEGVIAASKAVSLKVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAASGKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggcgtcgcggtaccg
cgcggcaagccggtcttctcggtggatgatgcggtcaaggccgcggaagagctcggcggc
ccggtgtgggtcgtcaaggctcagatccacgcaggtggccgtggcaagggcggcggcgtc
aaggtcgccaagtcgctggaacaggttcgcgagtactcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggtccggaaggccagaaggtcaatcgccttctgatcgaagaa
ggcgctgacatcaagaaggaactgtatgtcggtctcgtgatcgatcgcgtttcgcagaag
atcgtcgtgatggcgtcgagcgaaggcggcatggacgtcgaagaagtcgcggaaaagacg
cctgagctgatccacaaggttgctgtcgatccgtcgaccggcctgaaggactcggaagca
gacgacctcgcgaagaagatcggcgtgcccgacgcttcgatcccgcaagcccgcgcgatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcatcgctcgccgaaatcaacccg
ctgatcctgaccggcgacggcaaggtcatcgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgtcacccggaaatcgtcgcttaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtccaaattcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcaggcctcgcgatggcaacgatggacaccatcaagctgttcggc
ggcgaaccggcgaacttcctcgacgtcggcggaggagctacgaccgagaaggtcaccgaa
gcgttcaagatcatgctgaagaacccgaacctgaccgcgattctggtcaacatcttcggt
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgcggcgtcgaaggccgtgtcg
ctgaaggtgccgctcgtggtccgcatgaagggcacgaacgaagacctgggcaagaagatg
ctcgccgaatccggcctgccgatcatctcggcggacagcatggaagaagcggctcagaag
gtcgtcgcggctgcttcgggcaaggcgtaa

DBGET integrated database retrieval system