KEGG   Burkholderia sp. CCGE1002: BC1002_2590Help
Entry
BC1002_2590       CDS       T01217                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BC1002_2590
Enzymes [BR:bge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BC1002_2590
Exosome [BR:bge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1002_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2886614..2888113
Genome map
AA seq 499 aa AA seqDB search
MQDQYVLALDQGTTSSRAMLFDRRGNVVSTAQKEFQQIYPHPGWVEHDPQEIWSTQAGVA
AEAVTRAGMNGTSIAAIGITNQRETTIVWDRETGHPIYNAIVWQDRRTADFCDELKAQGL
EASVRAKTGLPIDSYFSATKIRWILDNVEGAREKARQGRLAFGTVDSWLMWNFTKGALHV
TDVTNASRTMLFNIHTLQWDDELLAALDIPRSMLPEVRPSSEVYGPTVTTVFASKIPLAG
IAGDQHAALFGQMCTESGMVKNTYGTGCFLVMNTGAKPIESKNNLVTTIAWQIGDRIDYA
LEGSIFIAGAVVQWLRDGLGIIRNAAEIETLARSVPHCDGVYLVPAFAGLGAPHWNARAR
GTLFGVTRGTTSAHIARAALDSIAYQSLDVLKAMEADSGIRIGELRVDGGACANNLLMQF
QADILGVDTVRPQVSETTALGAAYLAGLAVGYWKDIDELKSQWKLEHRFTPALPHAEVRT
CLDGWQRAIRAAKAWADTP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcagtacgtcctcgcgcttgaccaaggcaccaccagctcacgcgcgatgctg
ttcgaccgccgcggcaacgtcgtgtcgaccgcgcaaaaggaattccagcagatctacccg
cacccgggctgggtcgaacacgatccgcaggaaatctggtcgacgcaggccggggtcgcc
gccgaggcggtcacgcgagccggcatgaacggcacgtcgatcgcggcgatcggcatcacg
aaccagcgcgaaaccacgatcgtgtgggatcgcgaaaccggccacccgatctacaacgcg
atcgtctggcaggaccgccgcaccgccgacttctgcgacgaactgaaggcgcaaggtctc
gaagcgagcgtgcgcgcgaagaccggtctgccgatcgactcgtacttctcggcgaccaag
atccgctggattctcgacaacgtcgaaggcgcgcgcgaaaaagcgcgtcaaggccggctc
gcgttcggcaccgtcgacagctggctcatgtggaatttcacgaaaggcgcgctgcacgtc
accgatgtgaccaacgcgtcgcgcacgatgctgttcaacatccacacgctgcagtgggac
gacgagttgcttgccgcactcgacattccgcgcagcatgctgccggaagtgcggccgtcg
tcggaggtgtatggaccgactgtgaccaccgtgttcgcatcgaagattccgctcgcgggc
atcgccggcgatcagcacgccgcattgttcggccagatgtgcaccgagtccggcatggtc
aagaacacctacggcaccggctgcttcctcgtgatgaacacgggcgccaaaccgatcgaa
tcgaagaacaatctcgtcacgacgatcgcctggcaaatcggcgatcgtatcgactacgcg
ctcgaaggcagcatcttcatcgccggcgcggtggtgcagtggctgcgcgacggcctcggc
atcatcaggaacgcggccgaaatcgaaacgctcgcgcgcagcgtgccgcattgcgacggc
gtgtatctggtgcccgcgttcgccggcctcggcgcgccgcactggaacgcacgcgcgcgc
ggcacgctgttcggcgtcacgcgcggcacgacctccgcgcatatcgcgcgtgcggcgctc
gattcgatcgcgtatcaatcgctcgacgtgctgaaggcgatggaagccgactcgggcatt
cgcatcggcgagctgcgcgtggatggcggcgcctgcgcgaacaatctgctgatgcagttc
caggcggacatcctcggcgtcgacacggtgcgcccccaggtgtccgagacgaccgcgctc
ggtgccgcctatctggccggtctcgcggtcggctactggaaggatatcgacgagttgaaa
agccagtggaagctcgagcatcgcttcacgccggcgctgccgcacgcggaggtcaggacc
tgcctcgatggctggcagcgcgcgatccgcgcggcgaaggcctgggccgatacaccgtaa

DBGET integrated database retrieval system