KEGG   Burkholderia sp. CCGE1002: BC1002_2611Help
Entry
BC1002_2611       CDS       T01217                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BC1002_2611
Enzymes [BR:bge01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BC1002_2611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2908396..2908977
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGVLLEKNPPHLLVDCNGVGYEVDVPMSTFYNLPSTGERIVLLTQMIVREDAHLL
YGFGTAQERATFRELLKISGIGARMALAVLSGMSVAELAQTVTMQDAARLTRVPGIGKKT
AERLLLELKGKLGADLGAMAGATSPSDHASDILNALLALGYSEKEALAAIKNVPAGTGVS
EGIKLALKALSKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcgttctgctggaaaaaaacccgccgcatctgctcgtcgac
tgcaacggcgtcggctatgaagtggacgtgccgatgagcacgttctacaacttgccgtcg
acgggcgagcgcatcgtgctgctcacgcagatgatcgttcgcgaggacgcgcatctgctg
tacggcttcggcaccgcacaggaacgcgcgacgttccgcgagctgctgaagatttccggc
atcggcgcgcgcatggcgctcgcggtgctgtcgggcatgagcgtcgcggagctcgcacag
accgtcacgatgcaggacgccgcgcgcctcacgcgtgtgccgggcatcggcaagaagacc
gccgagcggctgctgctcgaactgaagggcaagctcggtgcggacctcggcgcgatggcg
ggcgccacgtcgccatccgaccacgcgtccgacatcctcaatgcgctgctcgcgctcggc
tactcggagaaagaagcgctcgcggcgatcaagaacgtgccggccggcacgggcgtgtcc
gagggcatcaagctcgcgctgaaggcgctgtcgaagggctga

DBGET integrated database retrieval system