KEGG   Burkholderia sp. CCGE1002: BC1002_2657Help
Entry
BC1002_2657       CDS       T01217                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bge  Burkholderia sp. CCGE1002
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2956588..2957001)
Genome map
AA seq 137 aa AA seqDB search
MARNWLRMKGVLIGAAALCALSGSAPEALARDYSAPAAAEAQVGTIALAQLPREAVDTLN
LIATGGPYPYQKDGIVFGNYERVLPAHRRGYYHEYTVPTPHERNRGARRIVCGGPLQRTD
NCYYSDDHYTSFNRIVE
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaactggttgcgcatgaaaggcgtgctgatcggtgctgccgcgctctgcgcg
ttgtcaggttcggcgcccgaggcgctggcgcgagattactcggcgccagctgcggcggaa
gcgcaggtaggcaccatcgcgctggcgcaattgccgcgcgaggccgtcgatacgttgaac
ctcattgctaccggcgggccttacccatatcagaaggacggcatcgtattcggcaactac
gaacgggtgctgcccgcccatcggcgaggctattaccacgaatacaccgtccccacgcct
cacgagcgtaatcgcggggcgcgccgcatcgtctgcggaggtccgctacagcgaaccgac
aattgttattactcggacgaccattacaccagttttaaccgtattgttgaatga

DBGET integrated database retrieval system