KEGG   Burkholderia sp. CCGE1002: BC1002_2702Help
Entry
BC1002_2702       CDS       T01217                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00330  Arginine and proline metabolism
bge00332  Carbapenem biosynthesis
bge01100  Metabolic pathways
bge01130  Biosynthesis of antibiotics
bge01230  Biosynthesis of amino acids
Module
bge_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BC1002_2702
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BC1002_2702
Enzymes [BR:bge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BC1002_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADG16750
JGI: BC1002_2702
UniProt: D5WDC4
Position
1:complement(3003981..3005099)
Genome map
AA seq 372 aa AA seqDB search
MRSVIADSRRLVVKVGSSLVTNDGRGLDHAAIGRWAAQIAELRAQGKEVVLVSSGAIAEG
MQRLGWTKRPREIDELQAAAAVGQMGLAQVYESRFAEHSIQTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQQGLFT
ADPRKNPNATLVQQADAGAPDLEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
READVLLRLAAGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDDGAVEKLTAGGKSL
LPIGIVGVQGAFARGEVIACLSASGREVARGLTNYSSAETRLIQRRPSGEIESVLGYMLE
PELIHRDNLVLL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgtcatcgcagattcacggcgattggtcgtcaaagtcggttcgagcctcgtc
acgaacgatgggcgcggcctcgatcatgcggcgattggccgctgggccgcacaaattgcc
gaactgcgcgcgcagggcaaagaagtggtgctggtcagctcgggcgcaatcgccgagggc
atgcagcggctcggctggacgaagcggccgcgtgaaatcgatgaattgcaggcggcagcg
gcggtcggccagatgggcctcgcgcaagtgtacgaaagccgcttcgccgagcactccatc
cagactgcgcagatcctgcttactcacgccgacctcgccgaccgcgagcgctatctgaat
gcgcgctccacgctgcttacgctgctgcggctcggagttgtaccgatcatcaacgagaac
gatacggtcgtcaccgacgagatcaagttcggcgacaacgacacgctcggcgcgctcgtc
gccaatctgatcgaaggcgatgcactgatcattctgacggatcagcaaggactcttcacc
gccgatccgcgcaagaacccgaacgcgacgctcgtccagcaagccgacgccggcgcgccc
gatctcgaggcgatggcgggcggcgcgggctcgagcctcggccgcggcggcatgctgacc
aagattcttgccgcgaagcgcgcagcccatagcggtgccaatacggtgatcgcgagtggg
cgcgaggcggatgtgctgctgagactggcggccggtgaggcgatcggcacgcagctaatt
gcgcgcaccgcgcgcatggcggcgcgcaagcaatggatggcggatcatctgcaggtgcgc
ggccacgtcgtgatcgacgatggagcggtcgaaaaactgaccgccggtgggaagagcctg
ctgccgatcggcatcgtcggcgtgcagggcgctttcgcgcgcggcgaggtgatcgcgtgt
ctgagcgcgtcgggccgcgaagtcgcacgtggtttgacgaactacagcagcgcggaaacc
aggctgatccagcgacgtccgagcggcgaaatcgagtcggtgctcggctatatgctcgag
ccggagctgattcatcgcgacaatctcgtgctgctttga

DBGET integrated database retrieval system