KEGG   Burkholderia sp. CCGE1002: BC1002_2744Help
Entry
BC1002_2744       CDS       T01217                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00071  Fatty acid degradation
bge00280  Valine, leucine and isoleucine degradation
bge00281  Geraniol degradation
bge00310  Lysine degradation
bge00360  Phenylalanine metabolism
bge00362  Benzoate degradation
bge00380  Tryptophan metabolism
bge00410  beta-Alanine metabolism
bge00627  Aminobenzoate degradation
bge00640  Propanoate metabolism
bge00650  Butanoate metabolism
bge00903  Limonene and pinene degradation
bge00930  Caprolactam degradation
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01212  Fatty acid metabolism
Module
bge_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BC1002_2744
   00650 Butanoate metabolism
    BC1002_2744
  Lipid metabolism
   00071 Fatty acid degradation
    BC1002_2744
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC1002_2744
   00310 Lysine degradation
    BC1002_2744
   00360 Phenylalanine metabolism
    BC1002_2744
   00380 Tryptophan metabolism
    BC1002_2744
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BC1002_2744
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BC1002_2744
   00281 Geraniol degradation
    BC1002_2744
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1002_2744
   00627 Aminobenzoate degradation
    BC1002_2744
   00930 Caprolactam degradation
    BC1002_2744
Enzymes [BR:bge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BC1002_2744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADG16792
JGI: BC1002_2744
UniProt: D5W4X4
Position
1:complement(3057108..3057884)
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETRGRVGLITLNRPKALNALNDALMDELGAALREFDADEAIGAIVVTGSEKA
FAAGADIGMMASYTYMDVYKGDYITRNWEAVRSIRKPIIAAVAGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRV
IPAASLLDEAVGAAATIAEFPLPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFGTEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaaaacattctggttgagacgcgggggcgggttggactgattacgctcaat
cgtccgaaggcgctaaatgcattgaacgacgcgctgatggacgaactgggtgccgcgttg
cgggagttcgatgccgacgaggcgattggcgcaatcgtcgtgacgggcagcgagaaagcg
ttcgcggccggcgcggatatcggcatgatggcgtcttacacctatatggatgtctacaag
ggtgactacatcacgcgcaactgggaagcggttcgctcgatccgtaagccgatcattgct
gcggtggcaggcttcgcgctcggcggcggctgcgaactggcgatgatgtgcgacatcatt
ttcgccgccgacacggcgaagttcggtcagccggaaatcaagctcgggatcatgccgggg
gcgggcggcacgcagcgcttgccgcgggcagtgtcaaaagcgaaggcgatggacctctgt
ttgaccgcccgtttcatggatgccgccgaagcggagcgcgccggactggtttcgcgcgtg
attccggctgcatcgctgcttgacgaagcggttggcgcggccgccaccattgcggaattc
ccgctgccggcggtgatgatggtcaaggagtcggtcaatcgagcctatgaaacgacgctc
gcggagggcgtgcattttgagcgtcgcctgttccattcgctctttggcaccgaagaccag
aaagaaggcatggccgcgttcgtagagaagcgcaaaccggttttcaaacaccgttaa

DBGET integrated database retrieval system