KEGG   Burkholderia sp. CCGE1002: BC1002_2762Help
Entry
BC1002_2762       CDS       T01217                                 

Definition
Disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bge  Burkholderia sp. CCGE1002
Brite
Enzymes [BR:bge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BC1002_2762
Secretion system [BR:bge02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BC1002_2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3075119..3075844)
Genome map
AA seq 241 aa AA seqDB search
MKKTFRIAAAALAIAAATLGCSAQADQTTDKLKATLQSRLSDVTIKGVSKTPIAGLYEVN
LGTQIIYSDASGDYLMLGDMVDSKTRKNLTEARLSETNRIDFASLPLGNAVKVVRGNGAR
KIAVFSDPNCPYCKQLEKSLQSIDNVTVYTFLYPVLSPDSTAKSKSIWCSADRAKAWESW
MQDRQAPTAAATCDTAAIDKNLALGRSMNVEGTPTVFLADGRRLPGAVPADRLDKELSAV
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccttccgcatcgccgccgccgcgctcgcgattgctgccgccacgctcggc
tgctcggcgcaggccgaccagaccaccgacaagctcaaagccaccctgcaaagccgtctg
tccgacgtgacgatcaagggcgtgtcgaagacgccgatcgcgggcctgtacgaagtgaac
ctcggcacgcagatcatctacagcgatgcgagcggtgactacctgatgctcggcgacatg
gtggactcgaagacgcgcaagaatctgaccgaggcgcgcctgtcggaaaccaaccgcatc
gacttcgcgagcctgccgctcggcaacgcggtgaaggtcgtgcgcggcaacggcgcgcgc
aagatcgcggtgttctccgatccgaactgcccgtactgcaagcagctcgaaaaatcgctg
cagtcaatcgacaacgtaacggtctacaccttcctgtacccggtgttgtcgcctgattcg
acggccaagtcgaagtcgatctggtgctcggccgaccgcgcgaaggcgtgggaatcgtgg
atgcaggaccgtcaggcgccgaccgccgccgccacctgcgacaccgccgcgatcgacaag
aacctcgcgctcggccgttcgatgaacgtggagggcacgccgacggtgttcctcgccgac
ggtcgccgtttgccaggtgccgtgccggccgaccggctcgacaaggaactgtccgcggtg
cactga

  All links  
No link information was found.   
DBGET integrated database retrieval system