KEGG   Burkholderia sp. CCGE1002: BC1002_2818Help
Entry
BC1002_2818       CDS       T01217                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bge01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bge00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3128411..3129745)
Genome map
AA seq 444 aa AA seqDB search
MSTKIRKLDSTARDFHKSLHAVLAFEASEDEAIERAVAQILNDVKARGDDAVLEYTNRFD
RIAAKSVAELELPMVELEAALESLEPKRRASLEAAAARVRGYHEKQKIECGSHSWQYTEA
DGTVLGQKVTPLDRAGIYVPGGKAAYPSSVLMNAIPARVAGVREIVMVVPTPDGVKNPLV
LAAALLGGVDRVFTIGGAQAVGALAYGTQTVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPRWVAMDLFSQAEHDELAQSILLCPDDAFIARVQEAIDELLPTM
PRHEVIRTSLENRGALIKVRDMAEACAIANDIAPEHLEISALEPHQWAQQIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFFKRSSLIEVSAEGAQTLGEIAAELA
YGEGLQAHARSAEFRMRQNNNERG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaagattcgcaaactcgattccaccgctcgcgactttcacaagtcgctgcat
gcggtgctcgccttcgaggcgagcgaagacgaagccatcgagcgcgcggtcgcgcagatt
ctgaacgacgtgaaggcgcgtggcgacgacgcggtgctcgagtacacgaaccgcttcgat
cgcatcgccgcgaaaagcgtggccgagctcgaactgccgatggtggagctcgaagcggcg
ctcgaaagtctcgagcccaagcggcgtgcgtcgctcgaagcggcggcggcgcgcgtgcgc
ggctatcacgagaaacagaagatcgagtgcggcagccatagctggcagtacaccgaagcg
gacggcaccgtgctcggccaaaaggtcacaccgctcgatcgcgcgggcatctatgtgccg
ggcggtaaggccgcgtatccgtcgtcggtgctgatgaacgcgattccggcgcgggtggcc
ggcgtgcgcgaaatcgtgatggtcgtgccgacgccggacggtgtgaagaatccgctcgtg
ctcgcggctgcactgctcggcggcgtcgatcgcgtgttcacgatcggcggcgcgcaggcg
gtgggcgcactcgcgtacggcacgcaaacggtgcccgcggtcgacaagatttgcggcccg
ggcaacgcgtatgtcgcgtcggcgaagcgtcgcgtgttcggcacggtcggcatcgacatg
atcgccgggccgtcggaaatcctcgtgctgtgcgacggcacgaccgatccacgctgggtc
gcgatggacctgttctcgcaggccgagcacgacgaactcgcgcagtcgatcctgctgtgc
ccggacgacgcgtttatcgcgcgcgtgcaggaagcgatcgacgaactgctgcccacgatg
ccgcgccacgaagtgatccgcacgtcgctcgaaaaccgcggcgcgctgatcaaggtgcgc
gatatggccgaggcctgcgcgatcgccaacgacatcgcgccggagcacctcgaaatttcg
gcgctggagccgcatcagtgggcgcagcagatccgccacgcgggcgcgatcttccttggc
cgctacacgagcgagagcctcggcgactactgcgcgggcccgaaccacgtgctgccgacg
tcgcgtaccgcacggttctcgtcgccgctcggcgtctatgatttcttcaagcgttcgagc
ctgatcgaggtcagcgcggaaggcgcgcaaacgcttggcgagatcgccgccgaactcgca
tatggcgaaggtctgcaagcgcacgcacgcagcgccgaattccggatgcggcagaacaac
aacgaacgcggctga

DBGET integrated database retrieval system