KEGG   Burkholderia sp. CCGE1002: BC1002_3186Help
Entry
BC1002_3186       CDS       T01217                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bge  Burkholderia sp. CCGE1002
Brite
Enzymes [BR:bge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BC1002_3186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:39..563
Genome map
AA seq 174 aa AA seqDB search
MAVQSGRLCKPWHVSPEGLSFTAVWESGVLNGVYQGHQVTEGFILKAYLDNVGIPTVGCG
HRIIVADHIEVGQVISLERAREFRRRNVAEVERRLNSGIHVPLFQYEYDALVSIVYNSGP
GRGADGIIGKINAGNYRNMHDFILTYRIGGNRGVRNRRVGEARLFSSGVYDASH
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtccaatcgggcagactctgcaaaccttggcatgttagtccggaaggattgtcc
tttactgccgtatgggagtccggtgtattaaatggcgtataccaggggcaccaagttaca
gaagggttcatcttaaaagcctatttggataacgttggaattcccacggttggatgcgga
catcgcattattgtggctgatcatattgaggttggacaggtaattagcctcgagcgtgcg
agagaatttagacggcgcaatgtcgctgaggtcgaaagacgacttaattccggtattcat
gttcccctgtttcaatatgaatacgatgcacttgtcagcattgtatataacagcgggccg
ggtcgcggtgcggacgggattatcggaaaaattaatgcaggaaattatcggaacatgcat
gattttatccttacgtatcgaattggaggcaatcgcggcgttagaaatcgccgagttggc
gaggctcgcttattttcgtcgggggtttacgatgcgtcgcactaa

DBGET integrated database retrieval system