KEGG   Burkholderia sp. CCGE1002: BC1002_3495Help
Entry
BC1002_3495       CDS       T01217                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00240  Pyrimidine metabolism
bge00250  Alanine, aspartate and glutamate metabolism
bge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BC1002_3495
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC1002_3495
Enzymes [BR:bge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BC1002_3495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace HTH_31
Motif
Other DBs
NCBI-ProteinID: ADG17528
JGI: BC1002_3495
UniProt: D5WGA9
Position
2:complement(321899..323191)
Genome map
AA seq 430 aa AA seqDB search
MSVPQQAFLRDAMRRLNMTRDTFANRIGVSRRALDTWLLPDDSQESRAMPEIVERFVSEI
VANTEPGEGYTQSVDSQSLASQMLFEGKPQLLSVDQFSRDSVEALFRVADIMQPIARRRK
ISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRVM
SGYVDALVIRHPEQGSVAEFARATNVPVINGGDGPGEHPSQALLDLYTIQREFSRLGKIV
DGAHIALVGDLKYGRTVHSLVKLLALYRGIKFTLISPPMLEMPGYIIEQISRNGHVIEQT
HDLRTGLRGADVVYATRIQKERFTDESFEGYTPDFQINQALVDSMCGADTLIMHPLPRDS
RPGANDLSTDLNHDSRLAIFRQTDNGIPVRMAIFAVLLGVDKQVQHSMRDATWRPPVYLG
PDDAVFHGID
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttccgcaacaagccttcctacgcgacgcgatgcgtcgtctcaacatgacgcgc
gatacgttcgctaaccgcatcggcgtgtcgcgccgggcgctggatacatggctgctgccg
gacgactcgcaggaatcgcgggcgatgccggaaatcgtcgagcgtttcgtgtcggagatc
gtcgcgaacacggagccgggcgaaggatatacgcaaagcgtagactcgcaatcgcttgca
agccagatgctgttcgagggcaagccgcagttgctgtcggtcgatcagttttcgcgcgac
tcggtcgaggcgctctttcgcgtcgccgacatcatgcagccgatcgcccggcgccgcaaa
atctcgcgcgtgctcgaaggcgcggtgctcggcaatctgttcttcgaggcgagcacgcgc
acccgcgtgagcttcggcgcggcgttctgccggctcggcggctcggtgtgcgacacgacc
ggcttcacgttttcgtcgatggccaagggcgaatcgatctacgacacgagccgcgtgatg
agcggctatgtcgacgcgctggtgatccgccacccggagcaaggctcggtggccgaattc
gcgcgcgcgaccaacgtgccggtgatcaacgggggagacggtcccggcgagcatccgagc
caggcgctgctcgatctgtacacgatccagcgtgagttctcgcgcctgggcaagatcgtc
gacggcgcgcatatcgctctggtcggcgatctcaagtacggacgtaccgtgcattcgctc
gtgaagctgctggcgctctatcgcggcatcaagttcacgctgatttcgccgccgatgctc
gaaatgccgggctatatcatcgagcagatttcgcgcaacggtcacgtgatcgaacagacg
cacgacctgcgcaccggtctgcgcggcgccgacgtcgtatatgcgacgcgcatccagaag
gagcgcttcaccgacgaatcgttcgaaggctacacgcccgactttcagatcaaccaggcg
ctcgtcgatagcatgtgcggcgccgacacgctgatcatgcacccgctgccgcgcgacagc
cgccccggcgcgaacgatctgagcaccgacctcaatcacgattcgcggctcgcgattttc
cggcagaccgacaacggcattccggtgcggatggcgattttcgcggtactgctcggcgtc
gacaaacaggtccagcattcgatgcgcgatgccacgtggcgcccgcccgtctacctcggc
ccggacgacgcagtgtttcacggcatcgattga

DBGET integrated database retrieval system