KEGG   Burkholderia sp. CCGE1002: BC1002_3562Help
Entry
BC1002_3562       CDS       T01217                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bge00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(397690..398877)
Genome map
AA seq 395 aa AA seqDB search
MRFRIDRRTSFALALGIGIAASASLAASSGTAQAAQNGAACGDWSAWRTFVQRFVQADGR
VIDYSTPTQQTTSEGQSYALFFALVANDRATFDKLLGWTRANLAGDQFDAQNLRLPAWQW
GKKPDGSYGVLDPNSASDSDLWIAYDLLQAGRLWHSPAYTQLGQALAERIAHDEVANLSG
LGPMLLPGAQGFRNGGVTRLNPSYLPLPLLRALAHEVPDGPWAKLADNAYQFVKTVSPQG
FAPDWAAWQNGRFVVDPKHGDVGSYDAIRVYLWAGLASPADPLAKPWLGALGGMRAKVAQ
NGFPPEKVSSTTGASSGEGPLSYWGALAPYFKTLGDEHGLGLARTRLAALDASVPGREPV
YYDRVLGLFGTGFIDGRYRFDEAGSLVPAWRAACD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttcggatcgacagaagaacctcctttgcgctggcgctcggtatcggcatcgcg
gcgtcggcgagtcttgcggcttcgagcggcaccgctcaggccgcgcagaacggtgccgcc
tgcggcgactggagcgcgtggcgaaccttcgtgcaacgcttcgtgcaggccgacggccgc
gtgatcgactactcgacgccgacccagcagaccacctcggaaggccagtcctacgcgctc
tttttcgcgctggtcgccaacgaccgcgcgaccttcgacaagctgctcggctggacccgc
gcgaatctcgctggcgaccagttcgacgcgcagaacctgcggctgcccgcgtggcaatgg
ggcaaaaagccggacggctcgtacggcgtgctcgatccgaattcggcatcggattccgac
ctctggattgcctacgacctgctgcaggccggccgcctgtggcacagccccgcctacacg
cagctcggtcaggcgctcgccgagcgcatcgcgcacgacgaagtcgcgaatctgtccggt
ctcgggccgatgctgctgccgggcgcgcagggtttcaggaacggcggcgtcacgcggctg
aatccgagctatctgccgctgccgctgctgcgcgcgctcgcgcacgaggtgccggacggc
ccgtgggccaagctcgccgacaacgcctatcagttcgttaaaaccgtgtcgccgcaaggc
ttcgcgcccgactgggcggcgtggcagaacggccggttcgtcgtcgatccgaagcacggc
gacgtcggcagttacgacgcgatccgcgtctatctgtgggccggcctcgcgtcgcccgcc
gatccgctcgcgaagccgtggctcggcgcgctcggcggcatgcgcgcgaaggtcgcacag
aacggcttcccgccggagaaggtgtcgtcgaccaccggcgcgtcgagcggcgaaggcccg
ctcagctactggggcgcgctcgcgccttacttcaagacgctgggcgacgagcatggcctc
ggcctcgcgcgcacgcggctcgccgcgctcgacgcgagcgtgccgggccgcgaaccggtg
tactacgatcgtgtgctcggtctgttcggcacgggattcatcgatggccgctaccgcttc
gatgaagccggcagcctcgtgcccgcctggagggccgcatgcgattga

DBGET integrated database retrieval system