KEGG   Burkholderia sp. CCGE1002: BC1002_3673Help
Entry
BC1002_3673       CDS       T01217                                 

Definition
fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BC1002_3673
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BC1002_3673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(524268..527684)
Genome map
AA seq 1138 aa AA seqDB search
MNRLSSAPTALQRHYEVVVIGSGYGGAIAASRMARAGRRVCVLERGREFMAGEYPRTPVQ
GVENIQYNTAEAQIGSPLALLEVHVNEDVNAVVGCGLGGTSLINANVALEADPRLWDDPR
WPAALRADKAGRDDGYGLARKMLSPSPVPDDFPPLPKLQALEKSAQALGMVDRFSRPPIT
VTFESGPNAAGVEQQRCVGCGDCNSGCNYDAKNSTHMNYLPDAVAHGAQIFTGTAVHSVL
RDADTQQWKVNFQLVKLGRESYDAPDLFVLADIVIVAAGTIGSTALLLRSRAAGLSTSEM
LGQHFTGNGDVLAFAYNTKDTINGVGWGEHKPGQIPPVGPTITGLIDNRAAEKNVRDGYV
IEEGSLAGPVGEALVGMLGAVAPLEGVDAAGAPSLLERVAYDARAIESLIRGPYHGALNH
TQSYLVMAHDDENGRIKIGDKGRARIEWKNAGRQPIFQTVEDVLIDATRPLGGKYLRNPI
STKIAGRRTVTVHPLGGCGMGEDAAHGVVDHLGRVFSGTDGAAVHDGLYVMDGAVMPMSL
GVNPLLTISALAERNCALLAKAHDWSIDYASKGTAAAPPAQKIGLRFTETMVGTYTPMVA
GDAATSPIEFTLTVESDDLADMLANPNHLARTAGTLTCPALSAQPLTISDGTFNLFVVDE
SDVDERNMNYRMTLDAAEGNTWYLSGKKIITRTSPINLWEQTNTLYAEIRASDKDDAPVV
GTATLIITPENFLKQQRTLEVTHAPDLKTRLEWTLKFGKFFAGVLFTEYGGVAAPLQFYD
PHTPPRAKRTLRAPAPQVTYFDTPDRTRLKLTRYFDPAADKESKPILLIHGSGVSSRIFS
TDLISTNLVEYLCASGYDVWLVDLRVSIELPSVLVPANVDMVAREDIPAAVAKIREVTGA
PNIQVLGHCLGGLALSMSLLYGLEGVRSAVISQVSAHPVPGTLQRIKAGLHIPDLMQHLR
VRDLTAYTQEDSWPANLYDEALRLYPVDHDEGCGNPICHRATFLYGLLYEHDKLNETLHA
NLQELFGIHDMAVFQHLATMVRAGHVVDARGDDVYLSGANGMKRLEGMRLPIGFIHGEKN
ETYLPVSTAHTFDLLRERFPEQPYERHLIPGYGHIDCIFGKNAAVDVYPLIVSYLNAH
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttatcgagcgcgccgacggcgctgcaacggcattacgaggtggtggtgatt
ggctcgggctacggcggcgcgatcgccgcgagccggatggcgcgtgcgggccggcgcgtc
tgcgtgctcgagcgcggccgcgaattcatggccggcgagtatccgcgcacgcctgtgcaa
ggcgtcgagaatatccagtacaacacggccgaggcgcagatcggttcgccgctcgcgctg
ctcgaagtgcacgtgaacgaggacgtcaacgcagtggtgggctgcgggctcggcggcacg
tcgctgatcaatgcgaacgtcgcgctggaggccgatccgcgcctgtgggacgacccgcgc
tggccggccgcgctgcgcgccgacaaagccggacgcgacgacggctatgggctcgcgcgg
aaaatgctgtcaccgtcgccggtgccggatgatttcccgccgctgccgaagctgcaggcg
cttgaaaaatcggcgcaggcgctcggcatggtggaccgcttcagccgtccgccgatcacg
gtcacgttcgagagcggcccgaacgcggcgggcgtcgagcagcagcgctgcgtcggttgc
ggcgattgcaactcgggttgcaactacgacgcgaagaactcgacccatatgaactatctg
cccgacgcggtcgctcacggcgcgcagattttcaccggcacggccgtgcattcggtgctt
cgcgatgccgacacgcagcaatggaaggtcaacttccagctcgtgaagctcggccgcgaa
agctatgacgcgcccgatctgttcgtgctggccgatatcgtcatcgtcgcggctggcacg
atcggctcgaccgcgctgctgctgcgctcgcgcgccgccggcttgagcacgtcggagatg
ctcggtcagcatttcaccggcaacggcgacgtgctcgccttcgcgtacaacacgaaggac
acgatcaacggcgtcggctggggcgagcacaagccagggcagattccgccggtcgggccg
accatcaccggcctgatcgacaatcgcgccgccgagaaaaacgtcagggatggctacgtg
atcgaggaaggctcgctggccggcccggtcggcgaagcgctcgtcggcatgctcggcgcg
gtcgcgccgctcgaaggcgtggatgcggccggcgccccgtcgctgctcgagcgcgtggcc
tacgacgcgcgcgcgatcgagagcctgatccgcggcccataccacggcgcgctcaatcac
acgcaaagctacctcgtgatggcgcacgacgacgaaaacggccgcatcaagatcggtgat
aaaggccgtgcgcgcatcgaatggaaaaacgccggacgccagccgatcttccagaccgtc
gaggacgtgctgatcgacgcgaccaggccgctgggcggcaaatatctgcgcaacccgatt
tcgacgaagatcgccggccggcgtaccgtgaccgtgcatccgctcggcggctgcggcatg
ggcgaggacgccgcgcatggcgtggtcgatcatctgggccgcgtgtttagcggcacggac
ggcgccgcggtgcacgacggcctctacgtgatggacggcgcggtaatgccgatgtcgctg
ggcgtcaatccgctcttgaccatctccgcgctcgccgaacgcaactgcgcgctgctggcc
aaagcgcacgactggtcgatcgattacgcgtcgaagggcaccgccgccgcgccgcccgcg
cagaagatcggcctgcgcttcaccgagacgatggtcggcacctacacgcccatggtggcg
ggcgacgccgccacgagcccgatcgaattcacgctgacggtcgagtccgacgatctcgcc
gacatgctggccaacccgaatcacctcgcgcgcaccgccggcacgctgacctgccccgcg
ctgtccgcgcaaccgctgacgatcagcgacggcacgttcaacctgttcgtcgttgacgag
tccgatgtcgacgagcgcaacatgaactaccggatgacgctcgacgcggccgaaggcaac
acctggtatctgagcggcaagaagatcatcacgcgcacgtcgccgatcaacctgtgggag
cagaccaacacgctgtatgcggagatacgcgcgtcggataaggacgacgcgcccgtcgtc
ggcaccgccacgctgatcatcacgccggaaaacttcctgaagcagcagcgcacgctcgaa
gtcacgcacgcgcccgacctgaagacgcgcctcgaatggacgctcaagttcggcaagttc
ttcgcgggcgtgctgttcaccgaatacggcggcgtggccgcgccgctgcagttctacgat
ccccacacgccgccgcgcgccaagcgcacgctgcgcgcgccggcgccgcaggtcacctac
ttcgacacaccggaccgcacgcggctcaagctcacgcgctacttcgatccagccgcggac
aaagagtcgaagccgatcctgctgatccacggctcgggcgtctcgagccgcatcttctcg
accgatctgatatcgaccaatctcgtcgaatatctatgcgcgtcgggctacgacgtatgg
ctcgtcgatctgcgcgtcagcatcgaactgccgagcgtgctcgtgccggccaacgtcgac
atggtcgcgcgcgaggacattcccgccgcggtcgcgaagattcgcgaagtgactggcgcg
ccgaacatccaggtgctcggtcactgtctgggcggcctagcgctcagcatgtcgctgcta
tacggactcgagggcgtgcgctcggcggtgatttcgcaggtgtccgcgcatccggtgccg
ggcacgttgcaacggatcaaggccggcttgcatattcccgacctgatgcagcatctgcgc
gtccgggacctgactgcctacacgcaggaagattcgtggcccgcaaacctgtacgacgaa
gcgctgcgtctctatccggtcgatcacgacgagggctgcggcaatccgatctgtcatcgc
gcgacgttcctgtatggcctgctctatgagcacgacaagctgaacgagacgctgcatgcg
aacctgcaggagctgttcggcattcacgacatggccgtgttccagcatctggccacgatg
gtgcgcgcgggccatgtcgtcgatgcgcgcggcgacgacgtgtatctgagcggcgcaaac
ggcatgaagcgactcgaaggcatgcgtctgccgatcggcttcattcacggcgagaagaac
gaaacctatctgccggtcagcacggcgcacactttcgacctgctgcgcgagcgcttcccc
gagcagccgtacgagcgccatctgattccgggctatgggcatatcgactgcatcttcggc
aagaacgcggcggtggatgtctatccgctgatcgtcagctatctgaacgcgcactga

DBGET integrated database retrieval system