KEGG   Burkholderia sp. CCGE1002: BC1002_3801Help
Entry
BC1002_3801       CDS       T01217                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC1002_3801
Enzymes [BR:bge01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BC1002_3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:664249..665340
Genome map
AA seq 363 aa AA seqDB search
MNGAMRGTDGVGSAGSASGTASRPVFPFAALIGQASLQQALVLAAIDPGLGGVLISGPRG
TAKSTAARALAELLPEGQLVNLPLGASEDRLIGTLDIETVLRDGSLRFSPGLLAKAHRGV
LYVDEVNLLPDALVDALLDAAASGVNTVERDGVSHSHDASFVLIGTMNPEEGELRPQLID
RFGLMVELQNAFEPQVRQAIVKARFAFDLDPAGFRAAYAEQQASYVQRIRSARAALPLLS
FDDAVHARVSTLCIDAAVDGLRADLVMLRAARALAAFERADAVTVGHVERVADAVLLHRR
RQHGSPRANQSHPESEARSQGVDRGASGDTARSSADSDWGYLPAEPTATVPVKRVIPLDV
KKR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatggagcgatgcgaggaacggacggcgtaggcagcgcgggctctgcgtcgggcacg
gcgtcgcggccggtttttccgtttgcggcgctgatcggccaagcctcgttgcagcaggcg
ctggtgctcgcggcgatcgatccgggtctgggcggcgtactgatcagcggaccgcgcggc
accgcgaagtcgaccgccgcgcgcgcgctcgccgagctgctgccggaagggcagctcgtg
aatctgccgcttggcgcgagcgaggatcgtctgatcggcacgctcgatatcgaaaccgtg
ttgcgcgacggctctttgcgcttctcgccggggctgctcgcgaaggcgcatcgcggcgtg
ctgtacgtcgatgaagtcaatctgctgcccgacgcgctcgtcgatgcgttgctcgatgcg
gcggcgagcggcgtgaatactgtcgaacgcgatggcgtgtcgcatagtcatgacgcgagc
ttcgtgctgatcggcacgatgaatcccgaagagggcgagttgcggccccagctgatcgac
cgcttcggtctgatggtggagttgcagaacgcgttcgagccgcaggtgcggcaggcgatc
gtcaaagcgcggttcgcgttcgatctcgatcccgccgggtttcgtgccgcctacgcggag
cagcaggcttcctacgtgcagcgaattcgctcggcgcgtgcggcgctgccgctgctgtcg
ttcgatgacgccgtccatgcgcgcgtgagcacgctatgcatcgacgcggccgtcgacggc
ctgcgcgccgatctcgtgatgctgcgcgcggcgcgcgcactggccgcgttcgaacgggcg
gatgcggtgacggtcggacatgtggagcgcgtcgccgatgcggtgctgcttcatcggcgg
cgtcaacatggttcaccgcgtgcgaatcagagtcatccggaaagcgaggcgcggtcgcaa
ggcgtcgatcggggtgcgtctggcgatacggcgagatcttccgccgactccgactggggc
tacctgccggccgagccgaccgcgactgtgcccgtcaaacgcgtcattccgctcgacgta
aaaaaacgctga

DBGET integrated database retrieval system