KEGG   Burkholderia sp. CCGE1002: BC1002_3881Help
Entry
BC1002_3881       CDS       T01217                                 

Definition
(RefSeq) phosphoketolase (EC:4.1.2.9)
  KO
K01621  
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BC1002_3881
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1002_3881
Enzymes [BR:bge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     BC1002_3881
    4.1.2.22  fructose-6-phosphate phosphoketolase
     BC1002_3881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(755982..758375)
Genome map
AA seq 797 aa AA seqDB search
MAEATSHPTPPQVLDPDTLRNLDRYWRACNYLSVGMIYLRDNPLLREPLKPEHIKNRLLG
HWGSDAGQSFVLVHLNRLIRKHDLDMIFLSGPGHGAPASLAHCYLEGTYSEVYPDRSEDE
DGMRRFFRQFSFPGGIGSHCTPETPGSIHEGGELGYCLSHGYGAAFDNPELIVTVMIGDG
EAETGPLATSWHSNKFLNPIRDGAVLPVLHLNGYKIANPTLLARIPHEELEALMVGYGHK
PYFVEGDDPDTMHQQMAATLEQCISEIRAIQQNARQNNDTTRPRWPMIVLRSPKGWTGPK
EVDGHKVEGSWRSHQVPVADAVTNRKSLKIVEDWLRSYGPETLFDANGRLVEELRALAPE
GARRISANPHANGGLLCKMLDMPSFRDYAVAVKKPAAGYTSPTAVLGTFLRDVMRKNMSN
FRLFGPDETSSNKLHAVYEVSGKTWLDPLEPSDADGGHLSADGRVMEMLSEHTLEGWLEG
YNLTGRHGLFATYEAFVHVIDSMFNQHAKWLEKSKRELGWRQPVPSLNLLITSIVWRQDH
NGFTHQDPGFLDVVTNKSPDVVRIYLPPDANCLLSVGDHCLRSRDYVNVIVSDKQPHLDY
LDMDAAVIHCTKGIGIWDWASTDQGAEPDVVMACAGDIATMEALAAVQILKEHCPTLKIR
FVNVVDLFRLMPEHAHPHGLSDRDFDSLFTTDKPVIFNFHAYAALVHKLTYNRKNHGNMH
VHGYNERGNINTPLELAIINGVDRFTLAIDAIDRVPTLRGVGDHTKEWLRGQIIEHLAYA
HEEGIDKEEIRNWTWKG
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcaacctcgcatcccaccccaccgcaagttctggaccccgatacgctgcgc
aacctcgatcgctactggcgcgcatgcaattatctgtcggtcggcatgatctatctgcgc
gacaacccgctgttgcgcgaaccgctgaagcccgagcacatcaagaaccggctgctcggc
cactggggttccgacgccggtcagagcttcgtgctcgtgcatctgaaccggctgattcgc
aaacacgatctcgacatgatctttctgtccggccccggtcacggcgcgccggcgagtctc
gcgcactgctatctggaaggcacctactcggaggtctatccggaccgcagcgaggacgaa
gacggcatgcggcgctttttccggcaattctcgttcccgggcggcatcggttcgcattgc
acgccggagacgccgggctcgattcacgaaggcggcgagctcggctactgcctgtcgcac
ggctacggcgccgcgttcgacaatcctgagctgatcgtcaccgtgatgatcggcgacggc
gaagcggagaccgggccgctcgccacctcgtggcattcgaacaaattcctgaacccgatc
cgcgacggcgcggtgctgcccgtgctgcatctgaacggctacaagatcgccaatccgacg
ctgctcgcgcgcattccgcatgaagagctcgaggcgttgatggtcggttacgggcacaag
ccatatttcgtcgaaggcgacgatcccgacacgatgcatcagcagatggcggcgacgctc
gaacaatgcatcagcgagattcgcgcgatccagcagaacgcgcggcagaacaacgacacc
acgcggccgcgctggccgatgatcgtgctgcgctcgccgaagggctggaccgggccgaaa
gaagtggacggtcacaaagtggaagggtcctggcgctcgcatcaggtgccggtggccgat
gcggtgaccaatcgcaagagtctgaagatcgtcgaggattggctgcgcagctacggtccc
gaaacgctgttcgatgcgaacggccggctcgtcgaagaactgcgcgcgctcgcgcccgaa
ggcgcgcgccgcatcagcgcgaatccgcacgcgaacggcgggctgctgtgcaagatgctc
gacatgccgtcgttccgcgattacgcggtggccgtgaagaaaccggcggcggggtatacg
tcgccgaccgcggtgctcggcaccttcctgcgcgacgtgatgcgcaagaacatgtcgaac
ttccggctgttcggtcccgatgaaacgtcgagcaataagctgcatgcggtttatgaagtg
tcgggcaagacctggctcgatcccctcgaaccgagcgacgccgacggaggccacctgtcg
gccgacggccgcgtgatggagatgctcagcgagcacacgctcgaaggctggctggaaggc
tataacctgaccggccgtcatgggctcttcgcgacctacgaagcgttcgtgcacgtgatc
gactcgatgttcaaccagcacgcgaaatggctcgaaaaatccaagcgcgagctcggctgg
cggcagccggtgccgtcgctcaatctgctgatcacgtcgatcgtgtggcgccaggatcac
aacggtttcacgcaccaggaccccggttttctcgacgtggtcacgaacaagagcccggat
gtggtgcgcatttacctgccgcccgatgcgaactgtctgctgagcgttggcgaccactgc
ctgcgctcgcgcgactacgtcaacgtgatcgtgtccgacaagcagccgcatctggattat
ctcgacatggacgcggccgtcattcactgcaccaaaggtatcggcatctgggactgggcg
tcgaccgatcagggcgccgagcccgacgtcgtgatggcgtgcgcgggcgacatcgcgacg
atggaagcgctcgccgcggtgcagatcctgaaggagcactgcccgacgctgaagatccgc
ttcgtcaacgtggtcgatctgttccgcctgatgcccgagcatgcgcatccgcatggactg
tccgaccgcgatttcgattcgctgtttacgaccgacaaaccggtgatcttcaacttccac
gcgtatgcggcgctcgtgcacaagctcacgtacaaccgcaagaaccacggcaacatgcac
gtgcatggctacaacgagaggggcaacatcaataccccgctcgaactcgcgatcatcaac
ggcgtcgaccgcttcacgctggcgatcgatgcgatcgatcgcgtgccgacgctgcggggc
gtcggcgatcatacgaaggagtggctgcgcgggcagatcatcgagcatctcgcgtatgcg
cacgaagaagggatcgacaaggaggaaatccgtaactggacgtggaaaggctga

DBGET integrated database retrieval system