KEGG   Burkholderia sp. CCGE1002: BC1002_4114Help
Entry
BC1002_4114       CDS       T01217                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BC1002_4114
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1002_4114
   00650 Butanoate metabolism
    BC1002_4114
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BC1002_4114
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1002_4114
   00622 Xylene degradation
    BC1002_4114
   00621 Dioxin degradation
    BC1002_4114
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BC1002_4114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1002559..1003500)
Genome map
AA seq 313 aa AA seqDB search
MTAKLKAAIIGSGNIGTDLMIKIMRHGKHLEMGAMVGIDPNSDGLARAARLGVAVTHEGA
QGLVNLPIFKDIDVVFDATSAGAHIKNDALLRQHKPNIRVIDLTPAAIGPYCVPVVNLDA
QIDAPNVNMVTCGGQATIPMVAAVSRVTKVHYGEIVASISSKSAGPGTRANIDEFTETTS
KAIEAVGGAAKGKAIIVLNPAEPPVMMRDTVYTLSDLADQAKIEASIDEMAKAVNAYVPG
YRLKQKVQFDVIPESAPINVPGLGKFSGLKTSIFIEVEGAAHYLPAYAGNLDIMTSAALA
TAERMAERMVAVA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaaaactcaaggccgcgattatcggctcgggcaatatcggcacggacctcatg
atcaagatcatgcggcacggcaagcatctggaaatgggggcgatggttggcatcgacccg
aattcggacggcttggcccgcgccgcgcgtctgggtgtcgcagtgacccacgaaggtgcc
cagggtctggtgaacctgccgattttcaaagacattgacgtggtgttcgatgccacgtcg
gcgggtgcccatatcaagaacgacgcattgctgcgtcagcacaagccgaacattcgcgtc
atcgatttgacgccggctgcgattggtccgtactgcgtgcccgtggtgaacctcgatgcg
caaatcgatgcgccgaacgtcaacatggtcacgtgcggtggacaggcaacgatcccaatg
gtggctgccgtgtcccgcgtgaccaaggtccactatggcgaaatcgtcgcctccatcagc
agcaaatcggccggtccgggcacgcgcgcgaacatcgacgagttcactgaaacgacctcg
aaggcgatcgaagccgtcggcggcgccgcgaagggtaaggcgatcatcgttctgaacccg
gctgaacctccggtgatgatgcgcgatacggtgtacacgctctccgatctcgcggatcag
gcgaagatcgaggcctcgattgatgagatggcgaaggctgtgaatgcttacgtgccggga
taccgtctgaagcagaaggtgcagttcgatgtgattccggaatcggcgcccattaacgtg
ccgggtctcggcaagttcagcggcctgaagacctcgattttcatcgaagtcgagggggcg
gcgcactatctgcccgcttatgcgggaaatctggacatcatgaccagcgcagccctcgct
acggcagagcgtatggctgaacgcatggtcgctgtggcataa

DBGET integrated database retrieval system