KEGG   Burkholderia sp. CCGE1002: BC1002_4131Help
Entry
BC1002_4131       CDS       T01217                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00010  Glycolysis / Gluconeogenesis
bge00071  Fatty acid degradation
bge00350  Tyrosine metabolism
bge00625  Chloroalkane and chloroalkene degradation
bge00626  Naphthalene degradation
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_4131
  Lipid metabolism
   00071 Fatty acid degradation
    BC1002_4131
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC1002_4131
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1002_4131
   00626 Naphthalene degradation
    BC1002_4131
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC1002_4131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ADG18129
JGI: BC1002_4131
UniProt: D5WI34
Position
2:complement(1020651..1021268)
Genome map
AA seq 205 aa AA seqDB search
MKAAVLHQYDESLTREEFVRYENVDDPKIVRPTDVIVRIGGAGVCRTDLHIVEGIWRSKV
DVALPYNMGHENAGWVEEVGRGVESVKVGDPVICHPLVTSGHCLACRRGDDMHATDSQFP
GINANGGYAQYLMTGERSLIQLPKLLAPKDVAPYTDAGLTAYRAAKKASRHLLPGQFVVV
IGAGGLGHIGISGSKRALRGRNHRG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctgctgtgctgcatcagtacgacgagtcattgactcgcgaagaattcgtgcgc
tacgaaaacgtcgacgatccgaagatcgtgcggccgaccgacgtgatcgtccggattggc
ggtgcgggagtgtgccgcaccgatctgcacatcgtggaaggcatctggcgcagcaaggtc
gatgtggcattgccctacaacatgggccatgaaaatgccggctgggtcgaagaggtgggc
cgcggtgtggagagtgtcaaggtgggcgacccggtcatctgccatccgctggtcacgagc
ggacattgcctcgcctgccgtcgcggagacgatatgcacgccacagacagccagtttccc
ggcatcaacgccaacggtggctacgcgcaatatctgatgactggcgaacgttcgctgatc
cagttgccgaaattgctggcgccgaaagacgtcgcgccgtataccgacgccggcttgacc
gcctaccgagctgcaaaaaaagcatcgcgccatttgctgcccggacaatttgtcgtcgtg
atcggcgccggcggtctggggcatatcgggatttcaggttctaaacgcgctttgcgcggc
cgaaatcatcgtggttga

DBGET integrated database retrieval system