KEGG   Burkholderia sp. CCGE1002: BC1002_4209Help
Entry
BC1002_4209       CDS       T01217                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00010  Glycolysis / Gluconeogenesis
bge00620  Pyruvate metabolism
bge00640  Propanoate metabolism
bge00680  Methane metabolism
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_4209
   00620 Pyruvate metabolism
    BC1002_4209
   00640 Propanoate metabolism
    BC1002_4209
  Energy metabolism
   00680 Methane metabolism
    BC1002_4209
Enzymes [BR:bge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BC1002_4209
Lipid biosynthesis proteins [BR:bge01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BC1002_4209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADG18202
JGI: BC1002_4209
UniProt: D5WIA7
Position
2:complement(1109044..1110735)
Genome map
AA seq 563 aa AA seqDB search
MTAAKAFLEARDLLVRHRTDYERAYREFTWPSLGEFNWALDYFDPIARNNDNPALWIVDD
PSSDGLRLSYAQMSERSSRMANFLRGAGVGRGDRVLLMLPNRVELWDVMLAAMKLGAIVL
PATTQLSADDVRDRVQIGGAKFAVVDSAELGKFNALDVPLTRLSVGAPRDGWIDVAGAYE
ASPDFRPDGVTRASDPMLLYFTSGTTSKPKLVEHTHQSYPIGHLSTMYWIGLQPGDIHWN
ISSPGWAKHAWSCFFAPWNAQACVFVFNVPRFVPKDTLAALVRFNVTTLCAPPTVWRMLV
QEPLGDYPVKLREIVGAGEPLNPEVIERVRHAWDITIRDGYGQTETTCQIGNSPGQPVVA
GSMGRPLPGYRVELLDADDQAVTEGEIALPLAERPLGLMTGYANNANATAQAMRNGFYRT
SDVALRRDDGYYVYVGRSDDVFKSSDYRLSPFELESVLIEHEAIGEAAVVPSADALRLSV
PKAFVTVRQGYEAGPELARAVFAFSREKLAPYKRIRRLQFSELPKTISGKIRRVELRRRE
MERAAEPARLPDEYWEEDFPDLR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagcgaaagcctttctcgaagcgcgcgatctgctagtgcgccatcgcaccgac
tacgagcgcgcgtaccgcgaattcacatggccgtcgctcggcgagttcaactgggcgctc
gactacttcgacccgatcgctcgcaacaacgacaaccccgcgctgtggatcgtcgacgat
ccttccagcgacggcctgcgtctgtcgtacgcgcagatgtcggagcgctcgtcgcggatg
gcgaactttctgcgcggcgcgggcgtcggtcggggcgaccgcgtgctgctgatgctgccg
aaccgcgtcgagctatgggacgtgatgctcgccgcgatgaagctcggcgcgatcgtgctg
cccgccaccacgcagctatccgccgacgacgtgcgcgaccgcgtgcagatcggcggcgcg
aagttcgccgtggtcgacagcgcggagctgggcaaattcaatgcgctcgacgtgccgctc
acgcgcttgtcggtcggcgcgccgcgcgacggctggatcgatgtcgccggcgcgtacgag
gcgtcaccggatttcaggccggacggcgtcacccgcgccagcgatccgatgctgctgtac
ttcacgtccggcaccacgtcgaagccgaagctcgtcgagcatacgcatcagagctatccg
atcgggcatctgtcgacgatgtactggatcggcctgcaacccggcgatatccattggaac
atcagctcgcctggctgggccaagcacgcgtggagctgcttcttcgcgccgtggaacgcg
caggcctgcgtgttcgtgttcaacgtcccgcgtttcgtgccgaaagacacactcgccgcg
ctggtgcgtttcaacgtgaccacgctgtgcgcgccgccgaccgtctggcgcatgctcgtg
caggagccgctcggcgactatccggtgaagctgcgcgagatcgtcggcgcgggcgagccg
ctgaatccggaggtcatcgagcgcgtcaggcatgcgtgggacatcacgatccgcgatggc
tacggtcagaccgagacgacctgccagatcggcaattcgccgggccagccggtcgtggcc
ggctcgatggggcgtccgctgccaggctaccgcgtcgaactgctcgatgccgacgaccag
gccgtgaccgaaggcgaaatcgcactgccgctcgccgaacggccgctcggcctgatgacc
ggctacgcgaacaacgccaacgcgaccgcgcaggcgatgcgcaacggcttctatcgcacg
tcggatgtcgcgctgcgtcgcgacgacggctactacgtgtatgtcggccgctcggacgac
gtgttcaagtcgtccgactatcgcctgagtccattcgaactcgaaagcgtgctgatcgag
cacgaggcgatcggcgaggcggccgtcgtgccgagcgcggacgcgttgcgtctgtcggtg
ccgaaggcgttcgtcaccgtgcgccaaggctacgaggccggtcctgaactcgcgcgcgcg
gtgttcgcgttttcgcgcgaaaaactcgcgccgtacaagcggattcgtcggctgcaattc
agcgaactgccgaagacgatctccggcaagatccgccgcgtcgagttgcggcgccgcgaa
atggagcgcgcggccgagcccgcgcgtctgcccgacgagtactgggaagaggatttcccc
gacttgcgttga

DBGET integrated database retrieval system