KEGG   Burkholderia sp. CCGE1002: BC1002_4721Help
Entry
BC1002_4721       CDS       T01217                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00360  Phenylalanine metabolism
bge00362  Benzoate degradation
bge00620  Pyruvate metabolism
bge00621  Dioxin degradation
bge00622  Xylene degradation
bge00650  Butanoate metabolism
bge01100  Metabolic pathways
bge01120  Microbial metabolism in diverse environments
bge01220  Degradation of aromatic compounds
Module
bge_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1002_4721
   00650 Butanoate metabolism
    BC1002_4721
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BC1002_4721
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1002_4721
   00622 Xylene degradation
    BC1002_4721
   00621 Dioxin degradation
    BC1002_4721
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BC1002_4721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADG18686
JGI: BC1002_4721
UniProt: D5WJP1
Position
2:complement(1651922..1652872)
Genome map
AA seq 316 aa AA seqDB search
MASEKLKAAIIGSGNIGTDLMIKILRHGKHLEVAAMVGIDPNSDGLARAARLGVATTHEG
VEGLTRLPVFEDIDFVFDATSAGAHVKNDAFLRACKPGIRLIDLTPAAIGPYCVPVVNLD
THLAAPNVNMVTCGGQATIPMVAAVSRVANVHYGEIVASISSKSAGPGTRANIDEFTETT
SKAIEVVGGAAKGKAIIVLNPAEPPVMMRDTVYTLSEMADLDKVEQSIQAMVAKVHAYVP
GYRLKQKVQFDEIPANAPLNIPGLGKFSGLKTSVFLEVEGAAHYLPAYAGNLDIMTSAAL
ATAERMAQALVQASEA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgaaaaactcaaggccgcgatcatcggctcgggcaacatcggcaccgatctg
atgatcaagatcctgcgtcacggcaagcatctcgaagtcgcggcgatggtcggcatcgat
ccgaactccgacggtctcgcgcgcgccgcgcggcttggcgttgctaccacgcatgaaggc
gtcgaaggtctgacgcgtctgcccgtgttcgaagacatcgatttcgtgttcgacgcgacc
tcggccggcgcacacgtgaagaacgatgcgttcctgcgcgcttgcaagcctggcattcgc
ctgatcgacttgacgcccgcggcgatcgggccgtactgcgtgccggtcgtcaatctcgac
acacacctcgccgcgccgaacgtgaacatggtcacctgcggcggtcaggcaacgatcccg
atggtcgcagccgtgtctcgcgtcgcgaacgtgcattacggggagatcgtcgcgtcgatc
agcagcaagtcggcgggcccaggcacgcgcgcgaatatcgacgagttcaccgagacgact
tcgaaggcgatcgaagtggtcggcggcgcggcaaaaggcaaggcgatcatcgtactcaac
ccggccgaaccgccggtgatgatgcgcgacaccgtctacacgctgtcggagatggccgac
ctcgacaaggtcgagcagtcgatccaggcgatggtcgcgaaggttcacgcctatgtgccc
ggctatcgcctgaagcagaaggtgcagttcgacgaaatccccgctaacgcgccgctcaat
attccgggcctcggcaagttcagtggtctgaagacttcggtgttcctcgaagtggaaggc
gccgcgcactacctgcccgcctatgccggcaatctcgacatcatgacttcggccgcgctc
gcgaccgccgagcgcatggcgcaggcgctcgtgcaggcatcagaggcataa

DBGET integrated database retrieval system