KEGG   Burkholderia sp. CCGE1002: BC1002_5198Help
Entry
BC1002_5198       CDS       T01217                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00020  Citrate cycle (TCA cycle)
bge00190  Oxidative phosphorylation
bge00650  Butanoate metabolism
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01200  Carbon metabolism
Module
bge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bge_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1002_5198
   00650 Butanoate metabolism
    BC1002_5198
  Energy metabolism
   00190 Oxidative phosphorylation
    BC1002_5198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADG19138
JGI: BC1002_5198
UniProt: D5WEL3
Position
2:2152974..2153342
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTAVVMAVYTVILLAWFFLARDFSYDGWASIFA
TQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGTRLVLQALTILWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaataaccgaatcggttcgaagcgtctcgtcgtcggcgcgcattacggtctg
cgcgactggctcgcgcaacgcgtcaccgccgtcgtgatggcggtgtacacggtgatcctg
cttgcatggttcttcctcgcgcgcgacttctcgtacgacggctgggcgtcgatcttcgcg
acgcagtggatgaagctcgccacgttcgtcacgcttctctcgctgttctatcacgcgtgg
gtgggtgtgcgcgacatctggatggactacgtgaagcccgttggcacgcgtctcgtcctg
caggcgctgacgatcctctggctgctcgcatgtgcgggctacgctgcgcagattctctgg
agagtataa

DBGET integrated database retrieval system