KEGG   Burkholderia sp. CCGE1002: BC1002_5211Help
Entry
BC1002_5211       CDS       T01217                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BC1002_5211
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1002_5211
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1002_5211
Enzymes [BR:bge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BC1002_5211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:2167093..2168286
Genome map
AA seq 397 aa AA seqDB search
MYNLPDERGHFGQFGGVFVAETLFSALDELREAYEKYQKDPEFVAEYERELKYFVGRPSP
IYHAQRWSELLGGAQVYLKREDLNHTGAHKINNVIGQALLAKRMGKPRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQRVIGDECRVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDKSVQLIGVEAAGDGIETGRHAASLIGGSPGVLHGNRTYLLQDEDGQIIET
HSVSAGLDYPGVGPEHAWLKESNRAQYVGITDEEALKAFHDCCRIEGIIPALESSHALAY
ATKLAPTLSKDKILLVNLSGRGDKDMHTVAERSGIQF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacttgcctgacgaaagaggccacttcggccagtttggcggcgtgttcgtagcc
gaaacgctgttttccgcactcgacgagctgcgcgaagcgtacgagaaatatcagaaagac
ccggaattcgtcgccgaatatgagcgcgaactgaagtacttcgtgggtcgtccgtccccg
atttatcatgcacagcgctggagcgaattgctcggcggcgcgcaggtctatctgaagcgt
gaagatctcaatcacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gccaagcgcatgggcaagccgcgtgtgatcgcggaaaccggtgccggtcagcacggcgtg
gccacggcgacgatctgcgcgcgcttcggcatggagtgcgtggtctacatgggcgccgag
gacgtgcgtcgccaagccgccaacgtgtaccgcatgaagctgcttggcgcgaccgtcgtg
ccggtcgaatcgggttcacgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcaccaacgtcgaaaacacgttctacatcattggcacggttgcgggtccgcatccgtat
ccgatgatggtgcgcgacttccagcgcgtgatcggcgatgaatgccgcgtgcaaatgccc
gagctcgccggtcgacagccagatgccgtcatcgcttgtgttggcggcggttcgaatgcg
atgggtatcttttatccctatatcgacgacaaatccgtgcagttgatcggtgtcgaagcg
gccggcgacggcatcgaaacgggtcgccacgcggcttcgctgatcgggggtagccccggt
gtgttgcacggcaaccgtacgtatctgctgcaggacgaagacggtcagatcatcgagacg
cattcggtgtcggcaggcctcgactatccgggcgtcgggcccgagcatgcgtggctaaaa
gagagcaatcgtgcgcaatatgtcggcatcaccgacgaagaggcgctgaaggcgttccac
gattgctgtcgtatcgagggcattattcctgcattggagtcgagccacgcgctcgcctat
gccacgaagctcgcgccgaccttgtccaaagacaagattctgttggtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggtatccagttctga

DBGET integrated database retrieval system