KEGG   Burkholderia sp. CCGE1002: BC1002_5211Help
Entry
BC1002_5211       CDS       T01217                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00260  Glycine, serine and threonine metabolism
bge00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01130  Biosynthesis of antibiotics
bge01230  Biosynthesis of amino acids
Module
bge_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1002_5211
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1002_5211
Enzymes [BR:bge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BC1002_5211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADG19151
JGI: BC1002_5211
UniProt: D5WEM6
Position
2:2167093..2168286
Genome map
AA seq 397 aa AA seqDB search
MYNLPDERGHFGQFGGVFVAETLFSALDELREAYEKYQKDPEFVAEYERELKYFVGRPSP
IYHAQRWSELLGGAQVYLKREDLNHTGAHKINNVIGQALLAKRMGKPRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQRVIGDECRVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDKSVQLIGVEAAGDGIETGRHAASLIGGSPGVLHGNRTYLLQDEDGQIIET
HSVSAGLDYPGVGPEHAWLKESNRAQYVGITDEEALKAFHDCCRIEGIIPALESSHALAY
ATKLAPTLSKDKILLVNLSGRGDKDMHTVAERSGIQF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacttgcctgacgaaagaggccacttcggccagtttggcggcgtgttcgtagcc
gaaacgctgttttccgcactcgacgagctgcgcgaagcgtacgagaaatatcagaaagac
ccggaattcgtcgccgaatatgagcgcgaactgaagtacttcgtgggtcgtccgtccccg
atttatcatgcacagcgctggagcgaattgctcggcggcgcgcaggtctatctgaagcgt
gaagatctcaatcacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gccaagcgcatgggcaagccgcgtgtgatcgcggaaaccggtgccggtcagcacggcgtg
gccacggcgacgatctgcgcgcgcttcggcatggagtgcgtggtctacatgggcgccgag
gacgtgcgtcgccaagccgccaacgtgtaccgcatgaagctgcttggcgcgaccgtcgtg
ccggtcgaatcgggttcacgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcaccaacgtcgaaaacacgttctacatcattggcacggttgcgggtccgcatccgtat
ccgatgatggtgcgcgacttccagcgcgtgatcggcgatgaatgccgcgtgcaaatgccc
gagctcgccggtcgacagccagatgccgtcatcgcttgtgttggcggcggttcgaatgcg
atgggtatcttttatccctatatcgacgacaaatccgtgcagttgatcggtgtcgaagcg
gccggcgacggcatcgaaacgggtcgccacgcggcttcgctgatcgggggtagccccggt
gtgttgcacggcaaccgtacgtatctgctgcaggacgaagacggtcagatcatcgagacg
cattcggtgtcggcaggcctcgactatccgggcgtcgggcccgagcatgcgtggctaaaa
gagagcaatcgtgcgcaatatgtcggcatcaccgacgaagaggcgctgaaggcgttccac
gattgctgtcgtatcgagggcattattcctgcattggagtcgagccacgcgctcgcctat
gccacgaagctcgcgccgaccttgtccaaagacaagattctgttggtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggtatccagttctga

DBGET integrated database retrieval system