KEGG   Burkholderia sp. CCGE1002: BC1002_5213Help
Entry
BC1002_5213       CDS       T01217                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BC1002_5213
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1002_5213
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1002_5213
Enzymes [BR:bge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BC1002_5213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:2169291..2170103
Genome map
AA seq 270 aa AA seqDB search
MSRIKNTFAALTAQGKKGLIPFMTAGDPDPARTVEFMRALAAGGADVIELGVPFSDPMAD
GPVIQQSSERALAKGVSLRHVLADVKRFRETDDNTPVVLMGYANPIERMGAEAFAEAAKE
AGVDGVLVVDYPPEECANFAQQMQSAGIDPIFLLAPTSTDERIAEVGRIASGYVYYVSLK
GVTGAANLDVSSIASKIPAIKSRVPLPVGVGFGIRDAQTARAVGEVADAVVIGSRIVQLL
EQAAPDAAAETLTRFVAEVREALDSVATAR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatcaagaacacgtttgccgcgctgaccgcccagggtaagaaaggcttgatc
ccgttcatgacggctggcgacccggacccggctcgcacggtcgaattcatgcgcgcgctc
gccgccggcggcgccgatgtcatcgaacttggcgtgccgttctccgacccgatggccgac
ggtccggtgatccaacagtcgtccgaacgcgcgctcgcgaagggcgtgtcgctgcgccac
gtgctggccgacgtcaaacgctttcgcgaaaccgacgacaacaccccggttgtgctgatg
ggctatgcgaatccgatcgagcggatgggtgccgaagccttcgctgaagctgcgaaagaa
gccggggtcgacggtgtgctggtggtcgattatccgcctgaagaatgcgctaacttcgcg
caacagatgcaatctgccggtatcgatccaatctttttgctcgcaccgacttcgaccgac
gaacgtatcgccgaagtcggccggatcgccagcggctacgtctactatgtgtcgctgaaa
ggggtcaccggcgccgcaaatctggacgtttccagcatcgcgagtaaaatcccggccatc
aagtcgcgcgtccccctgccagtgggcgtcggtttcggcattcgcgacgcgcaaacggcg
cgtgcggtgggcgaggtggccgatgccgtcgtgatcggcagccgtatcgttcaattgctc
gaacaggcagcgcccgacgccgctgccgagacgctcacgcgtttcgttgccgaagtgcgc
gaggcgctcgatagcgtcgcgactgcccgataa

DBGET integrated database retrieval system