KEGG   Burkholderia sp. CCGE1002: BC1002_5225Help
Entry
BC1002_5225       CDS       T01217                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1002_5225
Enzymes [BR:bge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BC1002_5225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2182556..2184754)
Genome map
AA seq 732 aa AA seqDB search
MTTRRPNDRLAALATRAGFEVEWQDAHHNTQHVPEKTLGTLLERMGLPCGNATDIRHSAA
ALEAELSGRRLPPLMTAVIGRGIALPAAAVKSGSHYRIELESGAIIDGRFTAPKGEEALL
APIDEAGYHTLVINDQRMTLAVAPPRCYTVADAWRTLHGGDGDGEAAPPMPPLWGIAAQL
YGLRRVGDGGIGDYTALAQLARHGAQRGAHALAVSPTHAMFSAQPERFSPYAPSSRLWLN
VTHIDPAAVFGADACASASAQTGNAASKYEELPLIDWPHATAVKFTVLRALYEQFNANER
SQHSPRALEFHGFCERAGRALEDHARFEALQAAQLAQGGDGHWRNWPDALRDPRSPEVEA
FAAAHRSEVDFHLFLQWLASRGLLHAQHTAREAGMAVGLIADLAVGCDSAGSHAWSYPDD
MLQGVSVGAPPDLFNQAGQSWGLTTFSPRAMRTQGFAAFIDMLRAAFSHAGGIRIDHILG
LRRLWLVPEGESARNGAYLRYPLEDLLRLIALESWRHRAIVIGEDLGTVPSGFRERLDEH
GIEGIRVLWFEGAPDGHGFKAPADWDRYAVGTTTTHDLPTVAGWWRGSDIMWRNRIGQTM
ARADGRDPEEAALEERAQQRADLWRAFQRAGVAAPDVAPPDADNPPVDEALAFVAATPGP
LVTFPLEDLLALAEQPNLPGSIDEHPNWRRRMTLPVDAMFDDPVFTDRLLAVDGARRAAA
PSPNTSAEPDTP
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacccgacgccccaacgaccggctcgccgcgctcgccacccgcgcaggcttcgag
gtggagtggcaggacgcgcaccacaacacgcagcacgtgcccgaaaagacactcggcacg
ctgctcgaacgcatgggtctgccgtgcggcaacgccaccgatatccgccacagcgccgct
gccctggaggccgaactatcgggccgccggctgccgccgctgatgaccgcggtgatcggg
cgtggcatcgcgctgcctgcggccgcggtcaagtcgggcagccattaccggatcgagctg
gagagcggcgcgatcatcgacggccgcttcaccgcgccgaaaggcgaggaagcgctgctc
gcgccgatcgacgaagccggctatcacacgctcgtgatcaacgaccagcgcatgacgctc
gcggtcgcaccgccgcgctgctacaccgtcgccgacgcatggcgcacgctgcacggcggc
gatggggacggcgaagccgcgccgcccatgccgccactgtggggcatcgccgcgcagctg
tatggcttgcgtcgcgtcggcgatggcggcatcggcgattacacggcgctcgcgcagctt
gctcggcatggcgcgcagcgcggcgcgcacgcgcttgccgtcagtccgacccacgcgatg
ttcagcgcgcagcccgagcgcttcagcccgtatgcgccgtcgtcgcgtttgtggctcaac
gtcacgcatatcgatccggccgcggtgttcggcgcggacgcgtgcgcatcggcatcggcg
cagaccggcaacgcagcgtcgaaatacgaagagctgccgctgatcgattggccgcacgcg
acagcggtgaaattcacggtattgcgcgcgctgtacgagcagttcaacgcgaacgagcgc
tcgcagcactcgccgcgcgcactcgaattccacggcttctgcgaacgcgcgggacgcgcg
ctcgaagatcacgcgcgcttcgaagcgctgcaggccgcgcaactcgcgcaaggcggcgac
ggccattggcgcaactggcccgatgcgttgcgcgacccgcgcagccccgaagtcgaggcg
ttcgccgccgcgcatcgcagcgaggtcgactttcatctgttcctgcagtggctggcctcg
cgcggcctgttgcacgcgcagcacacggcgcgcgaagccggcatggcggtcggcctgatc
gccgatctcgcggtcggttgcgacagcgccggaagccatgcatggtcctaccccgacgac
atgctgcagggcgtgtcggtcggcgcgccgcccgatctgttcaaccaggccggccagtcg
tggggactcaccaccttttcgccgcgcgcgatgcgcacgcaaggcttcgccgcgttcatc
gacatgctgcgcgctgcgttctcgcatgccggcggcatccgcatcgatcacattctcggc
ttgcggcgtctgtggctcgtgcccgaaggcgaaagcgcgcgcaacggcgcatatctgcgc
tatccgctcgaagacctgctgcggctgattgcgctcgaatcgtggcggcatcgcgcgatc
gtgatcggcgaggatctcggcaccgtgccgtccggttttcgcgagcggctcgacgagcac
ggcatcgaggggattcgcgtgctgtggttcgaaggcgcgcccgacggccacggcttcaag
gcacctgcagattgggaccgctatgcggtcggcacgacgaccacgcatgatctgccgacc
gtcgccggctggtggcgcggcagcgacatcatgtggcgcaaccgcatcggccagacgatg
gcgcgcgccgacggccgcgaccccgaagaagcggcgctcgaagagcgcgcgcagcagcgc
gccgacttgtggcgcgcgttccagcgagcgggcgtggccgcgcccgatgtcgcgccgccc
gacgccgacaacccaccggtcgacgaagcgctcgcattcgtcgccgcgacgcccgggccg
ctcgtcacgttcccgctcgaagacctgctcgcgctcgccgagcagccgaacctgccgggc
tcgatcgacgaacatccgaactggcgccgccgcatgacgctgcccgtcgacgcgatgttc
gacgaccccgtattcaccgatcgactgctggccgtcgacggcgctcgccgcgccgccgcg
ccttcaccgaacacttccgcggagcccgacacgccatga

DBGET integrated database retrieval system