KEGG   Burkholderia sp. CCGE1002: BC1002_5228Help
Entry
BC1002_5228       CDS       T01217                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1002_5228
Enzymes [BR:bge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BC1002_5228
Exosome [BR:bge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1002_5228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2189119..2191329)
Genome map
AA seq 736 aa AA seqDB search
MSEHDPAAGLQPVDIDALVEARHPDPFSQLGLHQTAAGPIVRALLPNAAHVTVISRADGA
TLGELEQLRPGLFAGRITSAMPYRLRIDWHGVEQEVEDTYSFGPVLGDEPLQRLAHGDPY
AVLECLGARPVDIDGVPGVRFAVWAPNARRVSVVGDFNAWDGRRHPMRLRHQAGVWELFV
PRVGAGTRYKYELLSRDGHPLPLKADPCAMQTEKPPGTASIVAHVDEIEQYPWTDHEWIQ
SRADKQTARTPITIYEVHAESWLRIAEEGQRGLVWEELAERLIPYAKSMGFTHIEFLPIA
EHPFGGSWGYQPLGQFAPSARFGKPEQFARFVDRAHEAGLGVILDWVPAHFPNDAHGLID
FDGTPLYEHADPREGYHQDWNTMIYNLGRNEVSAFLIASGLAWLQRYHVDGLRVDAVASM
LYRDYSRAAGEWVPNIYGGRENLESIAFLKRLNHEVRYVPGAPGAITVAEESTAWPGVTA
RVADGGLGFDFKWNMGWMHDTLHYMHEDPVYRQYHHHNMTFGMVYAYSERFVLPLSHDEV
VHGKGSLLGKMPGDRWQRFANLRAYFGFMWTHPGKKLLFMGGEFGQMAEFDHDGSPHWNL
LDDPGHHGVQLLVRDLNHLYRNEPALHLLDSEPGGFEWLIGDDSGNSVFAYRRTDGAGQE
FVVVCNMTPVPRLGYRLGMPRGGRWVEVLNTDAGVYGGSNMGNGGLIHSDPVSSHGRPHS
AALTLPPLATIVLRAD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcatgatccggccgcaggccttcaacccgttgacatcgacgcgctcgtcgaa
gcgcgtcaccccgatccgttttcgcagctggggctgcatcagaccgccgctgggccgatc
gtgcgcgcgctgctgccgaatgctgcgcacgtcaccgtgatttcgcgcgccgatggcgcg
acgctcggcgaactcgagcaactacggcctggcctgttcgcgggccgcatcacgtcggcg
atgccgtatcgcttgcgcatcgactggcatggcgtcgagcaggaagtggaggatacctat
tcgttcggtccggtgctcggcgacgagccgctgcaacgtctcgcgcacggcgatccatac
gcggtgctcgaatgtctgggcgcgcggccggtcgacatcgacggcgtgccgggcgtgcgc
ttcgcggtgtgggcgcccaatgcgcggcgcgtgtcggtggtcggcgacttcaacgcgtgg
gacggccgccgtcatccgatgcggctgcggcaccaggcgggcgtgtgggagctgttcgtg
ccgcgcgtcggcgccggcacgcgctacaagtacgagctgctgtcgcgcgacggccatccg
ctgcctttgaaggccgatccgtgcgcgatgcagacggaaaagccgccgggcacagcatcg
atcgtcgcgcatgtcgatgagatcgagcagtatccgtggaccgatcacgagtggatccag
tcgcgcgccgacaagcagaccgcgcgcacgccgatcacgatctatgaagtgcacgcggag
tcgtggctgcgcatcgccgaggaaggccagcgcggtctcgtctgggaagagctcgccgag
cggctgattccttacgcgaagagcatgggcttcacgcacatcgaatttctgccgatcgcc
gagcatccgttcggcggttcgtggggctatcagccgctcgggcagttcgcgccgtccgct
cggttcggcaagcccgagcagttcgcgcgtttcgtcgatcgcgcgcacgaagcggggctc
ggcgtgattctcgactgggtgcccgcgcatttcccgaacgacgcccacggtctgatcgat
ttcgacggcacgccgctctatgagcacgccgacccgcgcgaaggctatcaccaggactgg
aacacgatgatctacaacctcggccgcaacgaggtcagcgcgttcctgatcgcgtcgggg
ctcgcgtggttgcagcgctatcacgtcgacggcttgcgcgtggacgcggtcgcgtcgatg
ctgtatcgcgactactcgcgcgcggccggcgagtgggtgccgaacatttatggcggccgc
gagaatctcgaatcgatcgcgttcctgaagcgcttgaatcacgaagtccgctatgtgccg
ggcgcacccggcgcgatcacggtcgccgaggaatcgaccgcatggccgggcgtgaccgcg
cgagtcgcggacggcggcctcggcttcgacttcaagtggaacatgggctggatgcacgac
acgctgcactacatgcacgaagacccggtgtatcgccagtatcaccatcacaacatgacg
ttcggcatggtctacgcgtattccgagcgcttcgtgctgccgctttcgcacgacgaggtg
gtgcacggcaagggctcgctgctcggcaagatgcccggcgaccgctggcagcgtttcgcg
aatctgcgcgcgtacttcggtttcatgtggacgcacccgggcaagaagctgctgttcatg
ggcggcgaattcggccagatggcggagttcgaccatgacggctcgccgcattggaatctt
ctcgacgatccgggccaccacggcgtgcagttgctggtgcgcgacctgaaccatctgtat
cgcaacgagccggcgctgcatctgctcgacagcgaaccgggcggcttcgaatggttgatc
ggcgacgacagcggcaacagcgtgttcgcctatcggcgcaccgacggcgcgggccaggag
ttcgtcgtggtgtgcaacatgacgccggtgccgcggctcggctatcggctcggcatgccg
cgcggcgggcgctgggtggaagtgctcaataccgatgccggcgtgtacggcggctcgaac
atgggcaacggcgggctgatccattccgacccggtatcgagccacggcaggccgcattcc
gccgcgctgactttgccgccactcgcaacgatcgtattgcgcgcggactaa

DBGET integrated database retrieval system