KEGG   Burkholderia sp. CCGE1002: BC1002_6031Help
Entry
BC1002_6031       CDS       T01217                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bge00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:485194..487065
Genome map
AA seq 623 aa AA seqDB search
MTTPIVNLERGHTFSFSPDGEHFLLDGMPFQIRSGEMHPARIPREYWQHRIRMARAMGMN
CIALYVMWNYHEMHRGVFDFRSGNRDIEAFIRLCQSEQMWVLLRPGPYVCAEWDLGGLPC
WLLRDPDVQLRTDSATDPHYMAAVARYIDELVPRIKPLMSEHGGPILMIQIENEFGSYAS
NPSYLEELRQLWLRGGISGPFYTEDGLAQLERNHTTVTGGAIALSNGNAAQIATVRRKFP
SVPAMAGEVYPGWLTHWGEAGFAGVDYDLSGTLDTFMQARLSFNLYVIHGGTSFGFFAGA
NVDDSGNYQPDITSYDYCAPINEQGMATPKYLKYRDLIASYLPESLPAIPDAIATLDCTG
VGALMPTLYASIWDNLPAALPREHGVDPKSFEHYGQAFGFVLYRTPLPAHANGVLDISGV
HDYATVFLGEQYAGGVSRAQLPRKYAQSLDMMHRAPLVLPSARRNQGANTDGQGALEILV
EAMGRVNFGPALVDRKGLLDPVTMKHVDGSVSLLGEWDVYLLPMDETFIANLNEVCTNPR
KPGLFFKANVLLTEVGDTWLDMSNWTKGIVWVNGHNLGRYWNIGPQRRLYCPAPWLAQGN
NEVLVFDLHQIEAKPIPLADRLY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacgcccatcgtgaacctcgaacgcggccacaccttctcctttagccccgacggc
gaacatttcctgctcgacggcatgccattccagattcgcagcggcgagatgcatccagcg
cgcatcccgcgcgagtactggcaacaccgaatccgcatggcgagggcgatggggatgaac
tgcatcgcgttgtacgtcatgtggaattaccacgagatgcacagaggcgtgttcgacttc
cgcagcggtaaccgcgatatcgaggccttcatccgcctatgccaatccgagcagatgtgg
gtgctgttgcgccccgggccttatgtttgcgcagagtgggatctgggcggcctgccttgc
tggctgttgcgcgatccggacgtccagttgcggaccgactcggccaccgatcctcactac
atggcggcggtggcccgctatatcgacgaactggttccgcgtatcaagccattgatgagc
gagcacggcggaccgatcctgatgatccagatcgagaacgaattcggttcgtatgcgagc
aatccgtcttacctcgaagagctcaggcagctttggctcagaggaggcataagcgggccg
ttctacaccgaagacggtctcgcgcaactcgaacgcaatcacaccacggtgacgggcggc
gcgatcgcgctgagcaatggcaacgcagcgcaaatcgcaacggtgcgccgcaaattcccc
tcggtgcccgcgatggctggcgaggtgtacccggggtggctcacgcattggggcgaagcg
ggcttcgcgggcgtggactacgatctctccggcaccttggacacgttcatgcaggcgcga
ctgtcgttcaacctgtatgtgattcacggcggcacgagctttggcttttttgccggcgcg
aacgtcgacgattcaggcaactatcagcccgacatcacgagctacgactattgcgcgccg
atcaacgagcaaggcatggcgacaccgaagtacctcaagtatcgggacctgatcgccagc
tatctgcccgaatcgttgccagccatacccgatgccatcgccacgcttgactgcaccggc
gttggggccttgatgccaacgctgtacgcgtcgatctgggacaacctgcccgcagcactg
ccgcgcgagcatggcgtcgatccgaagtcgtttgaacactacggtcaggcgtttggcttc
gtgctgtatcgcacgccattaccggcgcacgcgaacggtgtgctggatatcagcggcgtt
cacgactatgcgaccgttttccttggggaacagtacgcgggcggcgtatcgagagcgcaa
ctgccgcggaagtacgcgcagtcgctcgacatgatgcatcgcgcgccacttgtcctgcct
tcggcgcggcggaatcaaggggcgaacacggacggccagggagcgctggagatactcgtc
gaggccatggggcgcgtcaacttcggacccgcgctcgttgaccgcaaaggtctgctcgat
ccggtcacgatgaaacacgtcgacggctcggtctcgttgctcggtgaatgggacgtctac
ctgctgccgatggatgaaacgttcatcgccaatctcaacgaagtctgcacgaacccgcgc
aaacccggtctttttttcaaggcgaatgtgctgctgaccgaagtcggcgacacgtggctc
gacatgagcaactggaccaagggtatcgtctgggtcaatggacacaacctcggacgctac
tggaacatcggcccgcaaaggcgcttgtactgccccgcgccgtggctcgcgcaaggtaac
aacgaggtgctggtcttcgaccttcatcagatcgaggcaaagccgatacccctggccgac
aggttgtactag

DBGET integrated database retrieval system