KEGG   Burkholderia sp. CCGE1002: BC1002_6293Help
Entry
BC1002_6293       CDS       T01217                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bge  Burkholderia sp. CCGE1002
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(767171..768331)
Genome map
AA seq 386 aa AA seqDB search
MRMLRAAAICTLAWTAGCTLSQAAAAHDGPPLAAAPAEALPPLRSVMAAHFKVGAAIEPD
SIDSPADATLIAAQFSSLTAENKMKPGTIGVAEGKYNFEPADKIIAFAQAHGIAVRGHTL
VWHFKAGDWTEAPAWFFAGDPKDPHYHDIVAKRLNRYVTDVVTHFRGKVYAWDVVNEVIS
DDPRQVYREDSPWYRALGKDYIAIAFRAAHAADPDVKLYINEYNTDDPRKRAKLLAVIRD
LRAQGVPIDGVGHQMHISVNWPPLPNVRQAFDDVAALGLENQVTELDVSLYTDPGECWSN
PHACLPDLGHPVPNDIMRAQAERYRAVFALFEQEPSIRAVTFWGYSDKHTWLTSTPVPRN
NLPLPFDANLNPKAALWTIVDSSYQP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgctccgcgcagcggccatttgtacactcgcatggaccgcgggctgcacgctc
agccaggcggctgccgctcatgacggcccgccgctcgccgcggcgcccgctgaagcgctg
ccgccactgcgcagtgtgatggccgcgcacttcaaggtcggcgcggcgatcgaacccgat
tcgatcgacagtcccgccgacgcgacgctgatcgccgctcagttctcgagcctcaccgcg
gagaacaagatgaagccgggcacgatcggcgtcgcagaaggcaagtacaacttcgagccg
gccgacaagatcatcgcgttcgctcaagcgcacggcattgcagtgcgcggccatacgctc
gtgtggcacttcaaggccggcgactggactgaggcgccggcctggttcttcgccggtgat
ccgaaagatccgcactatcacgacatcgtcgcgaagcggctcaatcgatatgtaaccgac
gtcgtcacacacttccgaggcaaggtctatgcgtgggacgtggtcaacgaggtgattagc
gacgatccgcgtcaggtgtatcgcgaagacagtccgtggtatcgagcgctcggcaaggac
tacattgcgatcgctttccgcgcggcgcacgcggcggacccggacgtgaagctctatatc
aacgagtacaacaccgacgatccgcgcaagcgcgcaaagctgcttgcggtgatccgcgat
ttgcgcgcgcagggcgtgccgatcgacggtgtcgggcatcagatgcacatcagcgtgaac
tggccgccactgccgaacgtcaggcaggcattcgacgacgtcgccgcgctaggcctcgaa
aaccaggtgaccgagctcgacgtgagcctatataccgatccgggagaatgctggagcaat
ccacatgcatgtctgccggacctcggccatccggttccgaacgacatcatgcgcgcgcag
gcggagcgttaccgcgcggtgttcgctctgttcgagcaggagccgagcatcagggcggtg
acgttctggggctactcggacaagcacacgtggttgacgtcgacgcccgtgccgcgcaac
aacctgccgctgccgttcgatgcgaacctgaacccgaaagcggcgctgtggacgatcgtc
gattcgtcgtatcagccgtaa

DBGET integrated database retrieval system