KEGG   Burkholderia sp. CCGE1002: BC1002_6325Help
Entry
BC1002_6325       CDS       T01217                                 

Definition
Di-hem cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bge  Burkholderia sp. CCGE1002
Brite
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BC1002_6325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:805124..806605
Genome map
AA seq 493 aa AA seqDB search
MRKVYAGALYVILSTLAACGGGGSSQSPSTDAGTGSTGSSGPAPTSTLSAAAQIGQQMFF
DKNLSGGKNQACASCHDPAFAYGPPNSLAVQLGSDGVSEGQRAVPSLRYKAMTPAYDDNA
SNPDGITANAPGGGFMWDGRGKTLADQVALPLLNPIEMNNASRDAVVQAVKNSAYAAKFT
AVYGPAVFGDTDTAFQDIGLALQAFQNEDPSFAPYSSKFDLYANNKIGGTLTPAEIRGMN
LFNDTDHGAGCVACHFMGANFNGSNALGTDFTYQAIGAPRNDASIPDNPNPIAANLNASY
YDMGLCGPINNGSYDSHTPLSATSGAGPDPFTGVNNPDPYCGRFKVPTLRNVAARNAFFH
NGVFHSLEQVVRFYNTRDTNPEYWYPSAGGDSTKLTSNPSYALQPSYAAGATVNMFNDLP
AAYRGNIDEELPLGQGQTDAGGTTALNGAQPRAVHSAPQLSDQDVQDVICFLNTLSDGYH
APATQPTSGSCVN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggtttatgcgggggcgctgtatgtcatcttgtcaacattggccgcttgcggg
ggcgggggctcgtcgcagtcgccttcgactgacgccggtacgggctcaacggggtcctcg
gggccggcgcctacgagcacactgagcgcggcggcccagatcggtcagcaaatgttcttc
gacaagaacctgtctggcggcaagaaccaggcatgcgcgtcctgccacgatccggcgttc
gcctacggcccgcccaacagcctggcggtgcagctcggttccgatggcgtatcggaaggc
cagcgcgcggttccctcgctgcgctataaggcgatgacgccggcctacgacgacaatgct
tcgaatccggacggcatcacggcgaacgcgccgggcggcgggttcatgtgggacggccgc
ggcaagacgctggccgatcaggtggcgctgcccctgctcaatcccatcgagatgaacaac
gcctccagggacgcggtggtgcaggcggtgaagaactccgcgtatgccgcaaagttcacg
gcggtgtacggcccggccgtgttcggcgatacggacacggcgttccaggacatcggactc
gcactgcaggccttccagaatgaggacccgagctttgcgccgtattccagcaagttcgac
ctgtatgcgaacaacaagatcggcggcacattgacgccggccgaaattcgcgggatgaac
ctgttcaacgacaccgatcacggggccggctgcgtggcctgtcatttcatgggcgccaac
ttcaacggctcgaacgcgctggggaccgacttcacctatcaggcgatcggtgcgccgcgc
aacgacgcgtcgatcccggacaatccgaaccccatcgcggccaacctgaacgcgagctac
tacgacatgggactgtgcggcccaatcaataacggcagctatgacagccacacaccgctt
tcggccaccagcggcgccggcccggacccatttacgggcgtgaacaacccggacccgtac
tgcggccgcttcaaggtgccgacgctgcgcaacgtcgccgcgcgcaacgcgttcttccac
aacggcgtgttccactcgctggagcaggtggttcgcttctacaacacacgcgacaccaac
cctgagtactggtatccgtccgcgggtggcgattcgaccaagctgaccagcaacccgagc
tatgcgctgcaacccagctatgcagcgggcgcgacggtgaatatgttcaacgatctgccg
gccgcctaccggggcaatatcgacgaggaactgccactggggcagggccagaccgacgcg
ggcggcaccaccgcgttgaacggcgcgcagccgcgtgctgtccattcggcgccgcaactg
tccgatcaggacgtgcaggacgtgatctgtttcctgaataccttgagcgacggctaccac
gctcccgcaacgcagcccacgagcggtagctgcgtgaattga

DBGET integrated database retrieval system