KEGG   Burkholderia sp. CCGE1002: BC1002_6472Help
Entry
BC1002_6472       CDS       T01217                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bge02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bge02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(958846..962928)
Genome map
AA seq 1360 aa AA seqDB search
MSKKRGQTLPSQALYPIVGIGASAGGLNALTEFFEALPARTSMAFVVVVHLSPDHESNLA
SLLQKVTSMPVLQVTSPTQIESDHVYLVAPSYEMIMVDGYLRVTRKPPEEGRRASIDLFF
RTLAEAHRERAIGIVMSGAGSDGSVGLSRIKEMGGITLVQDPSEAEYDSMPRSAIATGMA
DFVMTAAEMPQRLLDLWSTAREIHLPAVQPDEPEEDTVNESAERALREIMVILRTRTAHD
FRHYKRATVLRRIERRLQVNGITDLQAYRDYLHLHPEETQALLQDMLISVTNFFRDKEAF
DVLEREVLPALFENRGEPDRIRVWSVGCATGEEAYSLAMLLQERSLKSPEGVSFQVFATD
IDERAISFARIGLYPDSISADLTPARIRQFFTKDAAHFRIKKELREHMLFAHHNVLSDPP
FSRLDMICCRNLLIYLDREAQIEILKMFHFALRPGGVLFLGSSESADSVSSMFTVVDKRN
RIYRANMAVRGDTPVPIAISGTMSSRPLVTTVQPPGRRRFSFGDLHQRLVEQYAPPSVLV
SRESEIVHLSDRAGRFLQYSGGEPSHNIVAVVRPELRLELRTAIYQALHTNRSVEARRVR
IERDGRSYFVNMTARPVHDPEANADFVLVLFDEVEDSMANAETASVDVQKDPIISQLERE
LQRTKEQLQSTIEQSETSTEELKASNEELQAINEELRSATEELETSKEELQSINEELTTV
NAELKSKVEETGKINDDLHNLIAANDIGTIFVDRNICIKRYTPRATDVFSIIPSDIGRSL
LDITHRLEYDKLADDAAEAFDSLRLIERELKSNDGRWYLARFVPYRTTEDRIDGAVLSFI
DITGRRQAEDRLREGERRMRIVAEGTKDYAIITFDENGVINSWNAGAERIFGYSEAEMIG
QSADILYTDEDRAANVAKREFAEARLNGRAEEERWHLRKDGTRFFASGVLSRLDEPGISG
FAKITRDLGEFASDATSGRGTHVETLRAASEREAQRRRDEFLAVVSHELKHPLNLISASA
ELIARAPETRQNLNVSRATDTIRRTVIGQAQIIDDLLDISRVRTGKLSVVRTVVDMREIV
QRVCSAVQDDAAQRGITLSVEVTDAPVIIHADLTRIEQIVWNLISNALKFTQRGSIQVSL
QVNDHAEAVLRVSDTGTGIEASLLPHIFEMFQQSRDPGSRRGGLGIGLALVRDLVNLHGG
AVRAESDGVGRGATFTVTLPTHRLATRTSAGIEITGEPLKGTRILMVDDDAATVETFKLL
LESEGAEVRTATSGEEALTIINGNAPDIILSDIGMPGMDGMEFVGKLRGMPAMKSVICIA
VSGFGQQADVSAAEDAGFDAHLKKPVVLEDLLSIFARLRS
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaagcgagggcaaactctgcctagccaggcactctatccgatcgtcggtatc
ggcgcatcggcgggggggcttaacgcgctgacggaattcttcgaggcgctgcccgcgcgc
acgtcgatggccttcgtcgtggtggttcacctgtcgccggaccacgaaagcaatctggcc
tcgctgctgcagaaggtcaccagcatgccggtgctgcaggtcactagccccacgcagatc
gagtccgaccacgtctatctggtcgcgccctcgtacgagatgatcatggtcgacggctac
ctgcgcgtcacgcgcaagccgcccgaggaaggacgccgcgcgagcatcgatctgttcttc
cgcacgctggccgaggcgcaccgcgaacgcgcgatcggcatcgtgatgtcgggtgcgggc
tcggacggctcggtcggcctgtcgcgcatcaaggaaatgggcggcatcactctcgtgcag
gacccttccgaagcggaatacgacagcatgccgcgtagcgcgatcgcgaccggcatggcc
gacttcgtgatgaccgcggccgagatgccgcagcggctgctcgatctgtggtccaccgcg
cgggaaatccatctgccggccgtgcagccggacgagcccgaggaagacacggtcaacgag
tcggccgagcgcgcgctgcgcgagatcatggtgatcttgcgcacccgcaccgcgcacgac
ttccggcattacaaacgggctacggttctgcgccgtatcgaacgtcggctgcaggtcaac
ggcattacggatctgcaggcgtatcgcgattatctgcatctgcaccctgaagaaacgcag
gcgctgctgcaggacatgctgatcagcgtcaccaatttcttccgcgacaaggaagcgttc
gacgtactcgagcgcgaggtgttgccggcgctcttcgaaaaccgcggcgaaccggaccgc
atccgcgtctggtcggtgggctgcgcgaccggcgaggaagcgtattcgctcgcgatgctg
ctgcaggagcgctcgctgaagtcgcccgagggcgtgtcgttccaggtattcgcgaccgac
atcgacgagcgcgccatttcattcgcgcgcatcggcctgtacccggactcgatctcggcc
gacctgacgccggcgcgcatccgccagttcttcacgaaggacgccgcgcacttccggatc
aagaaggaactgcgcgaacacatgctgttcgcgcaccataacgtgctcagcgacccgccg
ttctcgcggctcgacatgatctgctgccgaaatctgctgatctatctggaccgcgaagcg
cagatcgaaattctgaagatgttccacttcgcgctgcggcccggcggcgtgctgttcctc
ggcagctcggagtcggccgacagcgtgagctcgatgttcaccgtggtcgacaagcgcaac
cgcatctatcgcgcgaacatggccgtgcgcggcgacacgccggtgccgatcgcgatttcg
ggcacgatgagttcgcgccctctcgttaccacggtgcagccgccggggcgccggcgcttt
tcgttcggcgatctgcatcagcggctcgtcgagcaatatgcgccgcccagcgtgctggtg
agccgcgaatccgaaatcgttcatctgtccgaccgcgccgggcgttttctgcagtattcg
ggcggcgagccttcgcataacatcgtggccgtcgtgcgtcccgaactgcggctcgaactg
cgcaccgcgatctatcaggccttgcacacgaaccgcagcgtcgaagcgcgccgggtgcgc
atcgagcgcgacggccgttcgtacttcgtcaacatgaccgcgcggccggtgcacgacccg
gaggcgaacgcggacttcgtgctggtgctgttcgacgaggtcgaagacagtatggccaac
gcggaaacagcgtcggtcgacgtgcagaaagacccgatcatcagccagctcgaacgcgag
ctgcaacgcacgaaggagcagctgcagtccaccatcgagcagtcggagacctcgaccgag
gagctgaaggcgtcgaacgaggaattgcaagcgatcaacgaggaactgcgctcggcgacc
gaggagctcgaaaccagcaaggaagagctgcaatcgatcaacgaagagctgaccacggtc
aacgcggaactgaagtcgaaggtcgaggaaaccggcaagatcaacgacgacctgcacaac
ctgatcgccgcgaacgacatcggcacgatcttcgtcgaccgcaacatttgcatcaagcgc
tatacgccgcgcgccaccgacgtcttcagcatcattccgtcggacatcggccgctcgctg
ctcgacatcacgcaccgcctcgaatacgacaagctcgccgacgacgcggccgaagcattc
gactcgctgcgcctgatcgaacgcgagctgaagagcaatgacgggcggtggtatctcgcg
cgcttcgtgccctaccgcacgacagaagaccgcatcgacggcgcggtgctgtcgttcatc
gacatcaccggccggcgtcaggcggaagaccggctgcgcgaaggcgagcggcgcatgcgc
atcgtcgccgagggcaccaaggactacgcgatcatcacgttcgacgaaaacggcgtgatc
aacagctggaatgcgggcgcggaacggattttcggctattcggaagccgaaatgatcggc
cagtccgccgacatcctgtacaccgacgaagaccgcgccgcgaacgtcgctaaacgcgag
ttcgccgaagcgcgtctgaacgggcgcgccgaagaggaacgttggcatctgcgcaaggac
ggtacgcgctttttcgcgagcggcgtgttgtcccgtctcgacgagccgggcatcagcggt
tttgcgaagatcacgcgcgatctcggcgagttcgccagcgacgcgacctcgggacgcggc
acccacgtcgaaacgctgcgcgcggcgagcgagcgcgaagcacagcgacgccgcgatgaa
tttctcgcggtcgtgtcgcacgagctcaagcatccgctcaacctgatttcagcgagcgcc
gaactgatcgcgcgcgcgccggaaacgcgccagaacctcaacgtgtcgcgcgcgaccgat
acgatccgccgcaccgtgatcggccaggcgcaaatcatcgacgatctgctcgatatttcg
cgcgtgcgcaccggcaagctgtcggtcgtgcgcacggtggtcgacatgcgcgagatcgtg
cagcgcgtgtgcagcgcggtgcaggatgatgccgcgcagcgtggcatcacattgagcgtc
gaagtgaccgatgcgcccgtgatcattcatgcggatctgacgcgtatcgagcagatcgtg
tggaatctgatcagtaatgcgctcaagttcacgcagcgcgggtcgatccaggtgtcgttg
caggtcaatgaccacgccgaggccgtgctgcgcgtcagcgataccggcaccggcatcgag
gcgtcgctgctgccgcatatcttcgagatgttccagcagagccgcgatccgggctcgcgc
cgcgggggcctcggtatcggcctcgcgctggtgcgcgatctggtcaacctgcacggcggc
gcggtgcgcgcggagtcggacggcgtcggccgcggcgcaacgttcacggtgacgctgcct
acccaccggctcgccacccgtacgagcgcgggaatcgaaatcaccggcgagccgctgaaa
ggcacgcgcatcctgatggtcgacgacgacgccgcgaccgtcgaaaccttcaagctgctg
ctggaaagcgagggcgccgaagtgcgcaccgcgacgagcggcgaggaagcgctgacgatc
atcaacggtaacgcgcccgatatcatcctgtccgacatcggcatgccgggcatggacggt
atggagttcgtcggcaagctgcgcggcatgccggcgatgaagtccgtgatctgtatcgcg
gtcagcggcttcggccagcaggcggacgtcagcgcggccgaagatgcgggcttcgacgcg
cacctgaaaaaaccggtggttctcgaagacctgctgagtattttcgcgcggctacgcagt
tga

DBGET integrated database retrieval system