KEGG   Burkholderia sp. CCGE1002: BC1002_6671Help
Entry
BC1002_6671       CDS       T01217                                 

Definition
alpha/beta hydrolase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bge01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bge00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bge00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bge00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1158133..1159242
Genome map
AA seq 369 aa AA seqDB search
MPIHMITMPKWGLSMEQGQVNGWLKEVGEKVAKGDEILDVETDKISSGVECAFDGTLRRQ
IAQQGDTLPIGALLGVVADAETSDADIDAAVEAFQRDFVPASADAADAGPQPEKAQIGGR
TLRYLKIGDGGTPAVLIHGFGGDLNNWLFNHADLGAHRAVWALDLPGHGESGKALDTGSL
DELADSVIAFLDDRGIERAHLVGHSLGSAVSMTVAAKAPERVASLALIAGAGLGDEINRE
YIEGFVEGSSRNTLKPHLVKLFADGSLVTRQLIEDIVKYKRLEGVNDALRKIALSAFEGG
VQTRVYRDRLDTLAPRTLVIWGAQDQIIPAAHAQGLPAQVRVHVIDGKGHMVQMEAASDV
NRLLNEFFG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcacatgatcacgatgcccaagtggggactgtcgatggagcaggggcaggtc
aacggctggctgaaggaggtcggcgaaaaagtcgcgaagggcgacgagatactcgacgtc
gagaccgacaagatttcgtcgggcgtcgagtgcgctttcgacggcacgctgcgccggcag
atcgcgcagcagggcgacacgctgccgatcggcgcgctgctcggcgtcgtcgcggacgcc
gagacgtccgatgccgacatcgatgctgccgtcgaggcgttccagcgcgacttcgtgccg
gcctccgcggatgccgcggacgcgggaccgcagccggaaaaagcgcagatcggcgggcgc
accctgcgttacctgaagatcggcgacggcggcacgcccgcggtgctgatccacggcttc
ggcggcgatctgaacaactggctcttcaatcatgcggatctcggcgcgcaccgcgccgtg
tgggcgctcgatctgccggggcatggcgagtcgggcaaggcgctcgacacgggcagcctc
gacgaactggccgacagcgtgatcgcgtttctcgacgaccggggtatcgagcgcgcgcat
ctggtcggccattcgttgggcagcgcggtgtcgatgacggtcgccgcgaaggcccccgaa
cgcgtcgcgtcgctggccttgatcgcgggcgcggggctcggcgacgagatcaaccgcgag
tacatcgaaggcttcgtcgagggcagcagccgcaacacgctgaagccgcatctggtgaag
ctgttcgccgacgggtcgctggtcacgcggcaattgatcgaagacatcgtcaagtacaag
cggctagaaggcgtgaacgacgcgctgcgcaagatcgccctgtccgcgttcgaaggcggg
gtgcaaacccgcgtctatcgcgaccggctcgacacgctggcaccgcgcacgctggtgatc
tggggggcgcaggaccagatcattccggccgcgcacgcgcagggcttgcccgctcaggtg
cgcgtgcacgtgatcgacgggaaagggcacatggtgcagatggaggctgcatcggacgtg
aaccgcctgctcaacgagttcttcggataa

DBGET integrated database retrieval system