KEGG   Burkholderia sp. CCGE1002: BC1002_6671Help
Entry
BC1002_6671       CDS       T01217                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00010  Glycolysis / Gluconeogenesis
bge00020  Citrate cycle (TCA cycle)
bge00620  Pyruvate metabolism
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01200  Carbon metabolism
Module
bge_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_6671
   00020 Citrate cycle (TCA cycle)
    BC1002_6671
   00620 Pyruvate metabolism
    BC1002_6671
Enzymes [BR:bge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BC1002_6671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Abhydrolase_5 Thioesterase Ndr Ser_hydrolase Esterase GCV_H FSH1
Motif
Other DBs
NCBI-ProteinID: ADG20510
JGI: BC1002_6671
UniProt: D5WMR4
Position
3:1158133..1159242
Genome map
AA seq 369 aa AA seqDB search
MPIHMITMPKWGLSMEQGQVNGWLKEVGEKVAKGDEILDVETDKISSGVECAFDGTLRRQ
IAQQGDTLPIGALLGVVADAETSDADIDAAVEAFQRDFVPASADAADAGPQPEKAQIGGR
TLRYLKIGDGGTPAVLIHGFGGDLNNWLFNHADLGAHRAVWALDLPGHGESGKALDTGSL
DELADSVIAFLDDRGIERAHLVGHSLGSAVSMTVAAKAPERVASLALIAGAGLGDEINRE
YIEGFVEGSSRNTLKPHLVKLFADGSLVTRQLIEDIVKYKRLEGVNDALRKIALSAFEGG
VQTRVYRDRLDTLAPRTLVIWGAQDQIIPAAHAQGLPAQVRVHVIDGKGHMVQMEAASDV
NRLLNEFFG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcacatgatcacgatgcccaagtggggactgtcgatggagcaggggcaggtc
aacggctggctgaaggaggtcggcgaaaaagtcgcgaagggcgacgagatactcgacgtc
gagaccgacaagatttcgtcgggcgtcgagtgcgctttcgacggcacgctgcgccggcag
atcgcgcagcagggcgacacgctgccgatcggcgcgctgctcggcgtcgtcgcggacgcc
gagacgtccgatgccgacatcgatgctgccgtcgaggcgttccagcgcgacttcgtgccg
gcctccgcggatgccgcggacgcgggaccgcagccggaaaaagcgcagatcggcgggcgc
accctgcgttacctgaagatcggcgacggcggcacgcccgcggtgctgatccacggcttc
ggcggcgatctgaacaactggctcttcaatcatgcggatctcggcgcgcaccgcgccgtg
tgggcgctcgatctgccggggcatggcgagtcgggcaaggcgctcgacacgggcagcctc
gacgaactggccgacagcgtgatcgcgtttctcgacgaccggggtatcgagcgcgcgcat
ctggtcggccattcgttgggcagcgcggtgtcgatgacggtcgccgcgaaggcccccgaa
cgcgtcgcgtcgctggccttgatcgcgggcgcggggctcggcgacgagatcaaccgcgag
tacatcgaaggcttcgtcgagggcagcagccgcaacacgctgaagccgcatctggtgaag
ctgttcgccgacgggtcgctggtcacgcggcaattgatcgaagacatcgtcaagtacaag
cggctagaaggcgtgaacgacgcgctgcgcaagatcgccctgtccgcgttcgaaggcggg
gtgcaaacccgcgtctatcgcgaccggctcgacacgctggcaccgcgcacgctggtgatc
tggggggcgcaggaccagatcattccggccgcgcacgcgcagggcttgcccgctcaggtg
cgcgtgcacgtgatcgacgggaaagggcacatggtgcagatggaggctgcatcggacgtg
aaccgcctgctcaacgagttcttcggataa

DBGET integrated database retrieval system