KEGG   Burkholderia sp. CCGE1002: BC1002_7181Help
Entry
BC1002_7181       CDS       T01217                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge01100  Metabolic pathways
bge01120  Microbial metabolism in diverse environments
bge02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bge00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BC1002_7181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ADG20921
JGI: BC1002_7181
UniProt: D5WNP2
Position
pBC201:complement(413329..414153)
Genome map
AA seq 274 aa AA seqDB search
MIRPHDTIAAALFALAPAVLADAAATRHAIARLRPPHGQRLVSCTNWISRMKWQPCRCAI
LVALATFAFGAPAHGEGDLVRGGQAARACMECHSFAPGRHMTGPSLAGVWGRKAGTAAGF
ARYSDALKRSGLVFDERHLDEWLTNPAAVVPGNAMDFPGIADARTRADLLAYLKAVSTGR
VSPPDRGLPNLKEADAASQVTAIRYCGDTYRLTMADGKIHAFWEFNLRFKTDGSVDGPLA
GKPVLLGTGMRGDRAAVVFSRPEEISGFIRRQCA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatacggccacacgatacgatcgccgctgcgctgtttgcacttgcgccagcggttctg
gcagacgcagccgcgacccggcacgccattgcgcggctacgcccacctcacggtcaacgc
ctggtctcgtgcacaaactggatctctcgaatgaagtggcaaccttgccgatgcgcgatc
ctggtcgcactggccacgtttgccttcggtgcgccagctcacggcgaaggcgacctcgtg
cgcggtggacaagccgcccgcgcctgcatggaatgtcattcgtttgcaccggggcggcac
atgacggggccgagtctggccggtgtttggggtcgcaaagcgggtaccgccgccggtttc
gcgcgctattcggatgcgctgaagcgatcgggtctggtgtttgacgaacggcacctggat
gagtggctcacgaaccctgcggcggtggttccaggcaatgcgatggactttcccggcatt
gccgatgcacgcactcgagccgatctgctcgcttacctcaaggcggtctccaccggtcgc
gtgtccccgcccgaccggggcctgccgaacctgaaggaggccgacgcggcttcgcaggtc
actgcgatccgttactgcggcgatacctaccgcctcactatggcggacgggaaaatccac
gccttctgggagttcaacctgcgattcaaaacagatggcagcgtcgacggcccgctcgcc
ggcaagcccgtactcctcggcaccggcatgcgtggcgaccgggccgcagtggtcttttcg
cgccccgaggaaatctcgggtttcattcggaggcaatgcgcgtga

DBGET integrated database retrieval system