KEGG   Burkholderia sp. CCGE1002: BC1002_7181Help
Entry
BC1002_7181       CDS       T01217                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BC1002_7181
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BC1002_7181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBC201:complement(413329..414153)
Genome map
AA seq 274 aa AA seqDB search
MIRPHDTIAAALFALAPAVLADAAATRHAIARLRPPHGQRLVSCTNWISRMKWQPCRCAI
LVALATFAFGAPAHGEGDLVRGGQAARACMECHSFAPGRHMTGPSLAGVWGRKAGTAAGF
ARYSDALKRSGLVFDERHLDEWLTNPAAVVPGNAMDFPGIADARTRADLLAYLKAVSTGR
VSPPDRGLPNLKEADAASQVTAIRYCGDTYRLTMADGKIHAFWEFNLRFKTDGSVDGPLA
GKPVLLGTGMRGDRAAVVFSRPEEISGFIRRQCA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatacggccacacgatacgatcgccgctgcgctgtttgcacttgcgccagcggttctg
gcagacgcagccgcgacccggcacgccattgcgcggctacgcccacctcacggtcaacgc
ctggtctcgtgcacaaactggatctctcgaatgaagtggcaaccttgccgatgcgcgatc
ctggtcgcactggccacgtttgccttcggtgcgccagctcacggcgaaggcgacctcgtg
cgcggtggacaagccgcccgcgcctgcatggaatgtcattcgtttgcaccggggcggcac
atgacggggccgagtctggccggtgtttggggtcgcaaagcgggtaccgccgccggtttc
gcgcgctattcggatgcgctgaagcgatcgggtctggtgtttgacgaacggcacctggat
gagtggctcacgaaccctgcggcggtggttccaggcaatgcgatggactttcccggcatt
gccgatgcacgcactcgagccgatctgctcgcttacctcaaggcggtctccaccggtcgc
gtgtccccgcccgaccggggcctgccgaacctgaaggaggccgacgcggcttcgcaggtc
actgcgatccgttactgcggcgatacctaccgcctcactatggcggacgggaaaatccac
gccttctgggagttcaacctgcgattcaaaacagatggcagcgtcgacggcccgctcgcc
ggcaagcccgtactcctcggcaccggcatgcgtggcgaccgggccgcagtggtcttttcg
cgccccgaggaaatctcgggtttcattcggaggcaatgcgcgtga

DBGET integrated database retrieval system