KEGG   Burkholderia sp. CCGE1003: BC1003_0409Help
Entry
BC1003_0409       CDS       T01314                                 

Definition
glycyl-tRNA synthetase subunit beta (EC:6.1.1.14)
Orthology
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bgf00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(453591..455693)
Genome map
AA seq 700 aa AA seqDB search
MTQPHQATLLVELLTEELPPKALARLGDAFAEGIAERLAARDLIEGELSFERYATPRRLA
VTVKNVRAVAPERHVREKVLPVSVALDKDGQPTAPLAKKLAALGFPDFSVSDLERAQDGK
AEAFFLRYAAPGATLAEGLQAALDETLTKLPIPKVMTYQRPDGSNVQFVRPAHRLTALHG
ERVVPVSALGIDADDTTLGHRFLSEGFVQIQHADAYVDTLMHKGRVVPNFADRKETIRTH
LLAHADGDQVVMPESLLDEVTSLVEWPVAYSCRFEDEFLQVPQECLILTMQTNQKYFALT
DANGKLRSRFLIVSNIETATPGDIIEGNERVVRPRLADAKFFFEQDKKKPLAERVPLLAN
VVYHNKLGSALQRVERLEGLAGAIAALIGADVALAKRAARLAKADLITDMVGEFPELQGT
MGTYYARHDGEPEEVALACSEHYQPRFSGDALPATATGTVVALADKLETLVGIWGIGLQP
TGEKDPFALRRHALGVLRILVEKQLAVDFVELLRTAHAQFAALPNVTDSTQAIYEFSMDR
LRGLLRERGHAPGEIDAVLALEPTRLDDIVARLVAVREFAALPEAGSLAAANKRISNILK
KSDSATVSGGVQPALFVEAAEKALHAQLEQVAPRVQSQLAARDYTGALTALAALREPVDT
FFNDVMVNAEDPALRANRLALLGALHQQLNCVADISRLAA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaccccatcaagctaccctgctggtcgaactgctgaccgaggaactgccgccc
aaagcgctcgcccgtcttggcgacgctttcgccgaaggtattgccgagcgtctcgcggcg
cgcgacctgatagaaggcgaactgtcgttcgagcgttacgcgacgccgcgccggctcgcc
gtcacggtgaagaacgtgcgcgctgttgcgccggaaaggcacgtgcgcgaaaaagtgctg
ccggtttcagtcgcgctggacaaggacggccagcccaccgcgccgctcgcaaagaaactc
gccgcgctcggcttccccgatttttcggtgagcgacctggagcgcgcgcaggatggtaag
gcggaagctttcttcctgcgctacgccgcgccgggcgccacgctcgcggaaggtctgcaa
gcggcgctcgacgaaacgctgacgaagctgcccattccgaaggtgatgacctatcagcgt
ccggacggctcgaacgtgcagttcgtgcgcccggcgcatcgcctgaccgcgctgcacggc
gaacgcgtcgtgccggtgagcgcgctcggcatcgacgccgacgacaccacgctcggccat
cgctttctgtccgaaggcttcgtgcagatccagcacgccgatgcgtacgtggacacgcta
atgcacaaaggccgcgtcgtaccgaatttcgcggatcgcaaggaaaccatccgcacgcat
ctgctcgcgcacgctgacggcgaccaggtggtgatgccggaatcgctgctggacgaagtg
acgtcgctggtcgaatggccggtggcttattcgtgccgcttcgaggacgagttcctgcaa
gtgccgcaggaatgtctgatcctgacgatgcagaccaaccagaaatacttcgcgctgacc
gatgcgaacggcaaactgcgctcgcgttttctgattgtgtcgaatatcgaaacggcgacg
cccggcgacattatcgaaggcaacgagcgcgtggtgcgcccgcgtctcgcagacgccaag
ttcttcttcgaacaggacaagaaaaagccgctcgccgagcgcgtgccgctgctcgcgaac
gtggtgtatcacaataagctgggctcggcgctgcaacgcgtggagcggctcgaagggctg
gcgggcgcaatcgctgctctgattggtgccgacgtggcgctcgccaagcgcgccgcgcgt
ctggccaaagccgatctgatcaccgacatggtcggcgaattccccgagctgcaaggcacg
atgggcacgtattacgcgcgccacgacggcgagccggaagaagtcgcgctcgcgtgctcg
gaacattatcagccgcgcttttccggcgacgcattgccggctaccgcaaccggcacggtg
gtcgcgctcgccgacaagctggaaacgctggtcggcatatggggcatcggtctgcaaccc
accggcgagaaagacccgttcgcgctgcgccgccacgcgctcggcgtgctgcgtattctg
gtcgagaagcaactggccgtggacttcgtcgaactgctgcgtacggctcacgctcaattc
gccgcgctgccgaacgtcaccgattcgacacaagccatctacgaattcagcatggaccgc
ctgcgcggtctgctgcgcgaacgcggccatgcgccgggcgaaatcgacgcggtgctggcg
ctcgagcccacgcgtcttgacgacatcgtcgcgcgcctcgttgcggtgcgcgagttcgcc
gcgttgccggaagccgggtcgctcgcggccgccaacaagcgcatctcgaacattctgaag
aagtcggacagcgcaaccgtgagcggcggcgtacagcccgcgctcttcgtcgaagcggcg
gagaaggccctgcacgcgcagctcgaacaggtcgcgccgcgcgtgcagtcgcaactcgcc
gcgcgcgactacacgggcgcgctcactgcgctcgccgcgctgcgtgaacccgtcgacacg
ttctttaacgacgtcatggtcaacgcggaagatccggcgttgcgcgcgaatcgtctggcc
ctgctcggcgcgctgcatcagcagctgaattgcgtcgcggacatttcccgactcgccgcc
tga

DBGET integrated database retrieval system