KEGG   Burkholderia sp. CCGE1003: BC1003_0409Help
Entry
BC1003_0409       CDS       T01314                                 

Definition
glycyl-tRNA synthetase subunit beta (EC:6.1.1.14)
Orthology
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BC1003_0409
Enzymes [BR:bgf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     BC1003_0409
Amino acid related enzymes [BR:bgf01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   BC1003_0409
Transfer RNA biogenesis [BR:bgf03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BC1003_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(453591..455693)
Genome map
AA seq 700 aa AA seqDB search
MTQPHQATLLVELLTEELPPKALARLGDAFAEGIAERLAARDLIEGELSFERYATPRRLA
VTVKNVRAVAPERHVREKVLPVSVALDKDGQPTAPLAKKLAALGFPDFSVSDLERAQDGK
AEAFFLRYAAPGATLAEGLQAALDETLTKLPIPKVMTYQRPDGSNVQFVRPAHRLTALHG
ERVVPVSALGIDADDTTLGHRFLSEGFVQIQHADAYVDTLMHKGRVVPNFADRKETIRTH
LLAHADGDQVVMPESLLDEVTSLVEWPVAYSCRFEDEFLQVPQECLILTMQTNQKYFALT
DANGKLRSRFLIVSNIETATPGDIIEGNERVVRPRLADAKFFFEQDKKKPLAERVPLLAN
VVYHNKLGSALQRVERLEGLAGAIAALIGADVALAKRAARLAKADLITDMVGEFPELQGT
MGTYYARHDGEPEEVALACSEHYQPRFSGDALPATATGTVVALADKLETLVGIWGIGLQP
TGEKDPFALRRHALGVLRILVEKQLAVDFVELLRTAHAQFAALPNVTDSTQAIYEFSMDR
LRGLLRERGHAPGEIDAVLALEPTRLDDIVARLVAVREFAALPEAGSLAAANKRISNILK
KSDSATVSGGVQPALFVEAAEKALHAQLEQVAPRVQSQLAARDYTGALTALAALREPVDT
FFNDVMVNAEDPALRANRLALLGALHQQLNCVADISRLAA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaccccatcaagctaccctgctggtcgaactgctgaccgaggaactgccgccc
aaagcgctcgcccgtcttggcgacgctttcgccgaaggtattgccgagcgtctcgcggcg
cgcgacctgatagaaggcgaactgtcgttcgagcgttacgcgacgccgcgccggctcgcc
gtcacggtgaagaacgtgcgcgctgttgcgccggaaaggcacgtgcgcgaaaaagtgctg
ccggtttcagtcgcgctggacaaggacggccagcccaccgcgccgctcgcaaagaaactc
gccgcgctcggcttccccgatttttcggtgagcgacctggagcgcgcgcaggatggtaag
gcggaagctttcttcctgcgctacgccgcgccgggcgccacgctcgcggaaggtctgcaa
gcggcgctcgacgaaacgctgacgaagctgcccattccgaaggtgatgacctatcagcgt
ccggacggctcgaacgtgcagttcgtgcgcccggcgcatcgcctgaccgcgctgcacggc
gaacgcgtcgtgccggtgagcgcgctcggcatcgacgccgacgacaccacgctcggccat
cgctttctgtccgaaggcttcgtgcagatccagcacgccgatgcgtacgtggacacgcta
atgcacaaaggccgcgtcgtaccgaatttcgcggatcgcaaggaaaccatccgcacgcat
ctgctcgcgcacgctgacggcgaccaggtggtgatgccggaatcgctgctggacgaagtg
acgtcgctggtcgaatggccggtggcttattcgtgccgcttcgaggacgagttcctgcaa
gtgccgcaggaatgtctgatcctgacgatgcagaccaaccagaaatacttcgcgctgacc
gatgcgaacggcaaactgcgctcgcgttttctgattgtgtcgaatatcgaaacggcgacg
cccggcgacattatcgaaggcaacgagcgcgtggtgcgcccgcgtctcgcagacgccaag
ttcttcttcgaacaggacaagaaaaagccgctcgccgagcgcgtgccgctgctcgcgaac
gtggtgtatcacaataagctgggctcggcgctgcaacgcgtggagcggctcgaagggctg
gcgggcgcaatcgctgctctgattggtgccgacgtggcgctcgccaagcgcgccgcgcgt
ctggccaaagccgatctgatcaccgacatggtcggcgaattccccgagctgcaaggcacg
atgggcacgtattacgcgcgccacgacggcgagccggaagaagtcgcgctcgcgtgctcg
gaacattatcagccgcgcttttccggcgacgcattgccggctaccgcaaccggcacggtg
gtcgcgctcgccgacaagctggaaacgctggtcggcatatggggcatcggtctgcaaccc
accggcgagaaagacccgttcgcgctgcgccgccacgcgctcggcgtgctgcgtattctg
gtcgagaagcaactggccgtggacttcgtcgaactgctgcgtacggctcacgctcaattc
gccgcgctgccgaacgtcaccgattcgacacaagccatctacgaattcagcatggaccgc
ctgcgcggtctgctgcgcgaacgcggccatgcgccgggcgaaatcgacgcggtgctggcg
ctcgagcccacgcgtcttgacgacatcgtcgcgcgcctcgttgcggtgcgcgagttcgcc
gcgttgccggaagccgggtcgctcgcggccgccaacaagcgcatctcgaacattctgaag
aagtcggacagcgcaaccgtgagcggcggcgtacagcccgcgctcttcgtcgaagcggcg
gagaaggccctgcacgcgcagctcgaacaggtcgcgccgcgcgtgcagtcgcaactcgcc
gcgcgcgactacacgggcgcgctcactgcgctcgccgcgctgcgtgaacccgtcgacacg
ttctttaacgacgtcatggtcaacgcggaagatccggcgttgcgcgcgaatcgtctggcc
ctgctcggcgcgctgcatcagcagctgaattgcgtcgcggacatttcccgactcgccgcc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system