KEGG   Burkholderia sp. CCGE1003: BC1003_0742Help
Entry
BC1003_0742       CDS       T01314                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BC1003_0742
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC1003_0742
Enzymes [BR:bgf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BC1003_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:845452..846477
Genome map
AA seq 341 aa AA seqDB search
MNTATQAPQDSADSATERFRYGFLKGNPQLTKNGELKHLLSIEGLPKAIVNHILDTASQF
VSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAATRLSADVLNLNINASSTSKGES
LLDTINNLSAMHADMFVVRHASSGAPYLIAQHCAPHVHVINAGDGRHAHPTQGLLDMYTI
RHYKKDFTNLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVRVF
HNLDEGLKDVDVIIMLRLQNERMSGALLPSAQEYFKSWGLTPERLALAKPDAIVMHPGPM
NRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNND
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgccacccaggccccgcaagattccgccgatagcgccaccgagcgcttccgt
tatggctttctgaagggcaacccgcagctcacgaaaaacggcgagctcaaacatctgttg
tcgatcgagggtttgccgaaggccatcgtcaatcacattctggacaccgcgagccagttc
gtcagcgtgacggatcgcgaggtgaagaaggtgccgcttctgcgcggcaagtcggtgttc
aatctgttcttcgaaaactcaacgcgcacgcgcaccacgttcgagattgcggccacgcgt
ttgtccgcggatgtgctgaatctgaacatcaatgcgtcgtcgacgagcaagggcgaatcg
ctgctggatacgatcaacaacctgtcggccatgcacgccgacatgttcgtcgtgcgtcat
gcgtcgagcggcgcgccgtatctgatcgcgcagcactgtgcgccgcacgtgcatgtgatc
aatgccggcgacggccgtcacgcgcaccccacgcaggggctgctcgacatgtacacgatc
cgccactacaaaaaggacttcacgaatctgcgcgtggcgattgtcggcgacattctgcat
tcgcgggtcgcccgctctgacattcatgcgctcaccacgctcggcgtgcccgaagtgcgc
gcgatcggcccgcgcacgctgctgccgggcggcctcgaacagatgggcgtgcgcgtgttc
cacaacctggacgaagggctgaaagacgttgacgtgatcatcatgctgcgtctgcagaac
gagcgcatgagcggcgcgctgctgccctcggcacaggagtatttcaagagctggggcctg
acgcccgagcggctcgcgctggcgaagcccgacgcaatcgtgatgcacccgggcccgatg
aaccgcggagtcgagatcgactcgcaggtcgcggacggtccgcagtccgtgatcctgaac
caggtgacgttcggtattgcggtgcgcatggcggtgatgggcatagtcgcgggcaacaac
gattga

DBGET integrated database retrieval system